BLASTX nr result
ID: Forsythia21_contig00039505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039505 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101044.1| PREDICTED: putative RING-H2 finger protein A... 80 5e-13 ref|XP_012854116.1| PREDICTED: putative RING-H2 finger protein A... 74 5e-11 gb|EYU23347.1| hypothetical protein MIMGU_mgv1a026003mg, partial... 74 5e-11 gb|EPS60496.1| hypothetical protein M569_14307 [Genlisea aurea] 57 6e-06 >ref|XP_011101044.1| PREDICTED: putative RING-H2 finger protein ATL21B [Sesamum indicum] Length = 392 Score = 80.1 bits (196), Expect = 5e-13 Identities = 41/77 (53%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = -1 Query: 230 YTFLNCSSVWTEYTSYDFVPLFCLSGENYIVLAMSSYSSLQPIPVSCHEIYHVSIPPQRY 51 YTFLNCSS + +YT ++PLFCLSG NY VLA++S S +P +C EI +VS+P Q Sbjct: 123 YTFLNCSSDYMDYTGTRYIPLFCLSGRNYTVLAVNSRSLGGGVPAACREIANVSVPLQWG 182 Query: 50 VSQ-YWSSMEVREDFQL 3 +SQ YW M++RED +L Sbjct: 183 LSQFYW--MDLREDLEL 197 >ref|XP_012854116.1| PREDICTED: putative RING-H2 finger protein ATL21B [Erythranthe guttatus] Length = 282 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 5/81 (6%) Frame = -1 Query: 230 YTFLNCSSVWTEYTS--YDFVPLFCLSGENYIVLAMSS--YSSLQPIPVSCHEIYHVSIP 63 YTFLNCSS + +YTS Y ++PLFCLSG N+ VLA ++ ++ +P +C +I V +P Sbjct: 119 YTFLNCSSDYLDYTSTRYYYMPLFCLSGRNHTVLATNTRPAAAAAEVPPTCRKIGSVLVP 178 Query: 62 PQRYVSQ-YWSSMEVREDFQL 3 Q ++Q YWS+M++RED QL Sbjct: 179 LQWTLAQFYWSAMDLREDLQL 199 >gb|EYU23347.1| hypothetical protein MIMGU_mgv1a026003mg, partial [Erythranthe guttata] Length = 265 Score = 73.6 bits (179), Expect = 5e-11 Identities = 39/81 (48%), Positives = 57/81 (70%), Gaps = 5/81 (6%) Frame = -1 Query: 230 YTFLNCSSVWTEYTS--YDFVPLFCLSGENYIVLAMSS--YSSLQPIPVSCHEIYHVSIP 63 YTFLNCSS + +YTS Y ++PLFCLSG N+ VLA ++ ++ +P +C +I V +P Sbjct: 119 YTFLNCSSDYLDYTSTRYYYMPLFCLSGRNHTVLATNTRPAAAAAEVPPTCRKIGSVLVP 178 Query: 62 PQRYVSQ-YWSSMEVREDFQL 3 Q ++Q YWS+M++RED QL Sbjct: 179 LQWTLAQFYWSAMDLREDLQL 199 >gb|EPS60496.1| hypothetical protein M569_14307 [Genlisea aurea] Length = 385 Score = 56.6 bits (135), Expect = 6e-06 Identities = 29/80 (36%), Positives = 46/80 (57%), Gaps = 4/80 (5%) Frame = -1 Query: 230 YTFLNCSSVWTEYTSYDFVPLFCLSGENYIVLAMSSYS-SLQPIPVSCHEIYHVSIPPQR 54 +TF NCS+ + +TS +F P+ CLSGENY VLA++ S + +P C + +P Q Sbjct: 121 FTFYNCSASYANFTSTNFTPVSCLSGENYTVLAVNRISPAAVDVPAVCRPFATIPVPLQW 180 Query: 53 YV---SQYWSSMEVREDFQL 3 + S W ++RED ++ Sbjct: 181 TMMSQSSSWLPGDLREDLEI 200