BLASTX nr result
ID: Forsythia21_contig00039406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039406 (208 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008459324.1| PREDICTED: pentatricopeptide repeat-containi... 83 6e-14 ref|XP_012438998.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 gb|KJB51197.1| hypothetical protein B456_008G205900 [Gossypium r... 82 1e-13 ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein... 82 1e-13 ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_009597258.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 gb|KDO52659.1| hypothetical protein CISIN_1g005305mg [Citrus sin... 80 4e-13 ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-13 emb|CBI15662.3| unnamed protein product [Vitis vinifera] 80 5e-13 ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citr... 80 5e-13 ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containi... 80 5e-13 emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] 80 5e-13 gb|KHN11615.1| Pentatricopeptide repeat-containing protein, chlo... 79 9e-13 ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containi... 79 9e-13 gb|KHN21346.1| Pentatricopeptide repeat-containing protein, chlo... 79 1e-12 ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containi... 79 1e-12 ref|XP_009768933.1| PREDICTED: pentatricopeptide repeat-containi... 77 3e-12 gb|KHN13611.1| Pentatricopeptide repeat-containing protein, chlo... 77 4e-12 ref|XP_010037424.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 gb|KCW49141.1| hypothetical protein EUGRSUZ_K02731 [Eucalyptus g... 77 4e-12 >ref|XP_008459324.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis melo] gi|659118823|ref|XP_008459325.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis melo] Length = 704 Score = 83.2 bits (204), Expect = 6e-14 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+ IKLIAM+TKREIV+RDASRFHHFRD NCSCGDYW Sbjct: 666 DCHSVIKLIAMITKREIVIRDASRFHHFRDGNCSCGDYW 704 >ref|XP_012438998.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Gossypium raimondii] gi|763784127|gb|KJB51198.1| hypothetical protein B456_008G205900 [Gossypium raimondii] Length = 702 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 664 DCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >gb|KJB51197.1| hypothetical protein B456_008G205900 [Gossypium raimondii] Length = 548 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 510 DCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 548 >ref|XP_007037975.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] gi|508775220|gb|EOY22476.1| Pentatricopeptide repeat superfamily protein [Theobroma cacao] Length = 702 Score = 82.0 bits (201), Expect = 1e-13 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 664 DCHNAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 702 >ref|XP_004148701.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Cucumis sativus] gi|700197289|gb|KGN52466.1| hypothetical protein Csa_5G636580 [Cucumis sativus] Length = 706 Score = 81.3 bits (199), Expect = 2e-13 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+ IKLIAM+TKREIV+RDASRFHHFRD +CSCGDYW Sbjct: 668 DCHSVIKLIAMITKREIVIRDASRFHHFRDGSCSCGDYW 706 >ref|XP_009597258.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Nicotiana tomentosiformis] Length = 702 Score = 80.5 bits (197), Expect = 4e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIAM+TKREIVVRDASRFH F+D CSCGDYW Sbjct: 664 DCHNAIKLIAMITKREIVVRDASRFHRFKDGTCSCGDYW 702 >gb|KDO52659.1| hypothetical protein CISIN_1g005305mg [Citrus sinensis] Length = 703 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIAMVT REIVVRDASRFHHF+D CSCGDYW Sbjct: 665 DCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >ref|XP_006477030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Citrus sinensis] Length = 703 Score = 80.5 bits (197), Expect = 4e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIAMVT REIVVRDASRFHHF+D CSCGDYW Sbjct: 665 DCHNAIKLIAMVTGREIVVRDASRFHHFKDGMCSCGDYW 703 >emb|CBI15662.3| unnamed protein product [Vitis vinifera] Length = 657 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 619 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 657 >ref|XP_006440110.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] gi|557542372|gb|ESR53350.1| hypothetical protein CICLE_v10019093mg [Citrus clementina] Length = 703 Score = 80.1 bits (196), Expect = 5e-13 Identities = 35/39 (89%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIAMVT REIVVRDASRFHHF+D CSCGDYW Sbjct: 665 DCHNAIKLIAMVTGREIVVRDASRFHHFKDGICSCGDYW 703 >ref|XP_002280013.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Vitis vinifera] Length = 704 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 666 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >emb|CAN62482.1| hypothetical protein VITISV_010810 [Vitis vinifera] Length = 704 Score = 80.1 bits (196), Expect = 5e-13 Identities = 33/39 (84%), Positives = 38/39 (97%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIA+VT+REIVVRDASRFHHF+D +CSCGDYW Sbjct: 666 DCHSAIKLIALVTRREIVVRDASRFHHFKDGSCSCGDYW 704 >gb|KHN11615.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 690 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIK IAMVT REIVVRDASRFHHFRD +CSCGDYW Sbjct: 652 DCHSAIKFIAMVTGREIVVRDASRFHHFRDGSCSCGDYW 690 >ref|XP_003533538.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 690 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIK IAMVT REIVVRDASRFHHFRD +CSCGDYW Sbjct: 652 DCHSAIKFIAMVTGREIVVRDASRFHHFRDGSCSCGDYW 690 >gb|KHN21346.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 548 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIAMVT REIVVRDASRFHHFR+ +CSCGDYW Sbjct: 510 DCHSAIKLIAMVTGREIVVRDASRFHHFRNGSCSCGDYW 548 >ref|XP_003531467.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic-like [Glycine max] Length = 691 Score = 79.0 bits (193), Expect = 1e-12 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIAMVT REIVVRDASRFHHFR+ +CSCGDYW Sbjct: 653 DCHSAIKLIAMVTGREIVVRDASRFHHFRNGSCSCGDYW 691 >ref|XP_009768933.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Nicotiana sylvestris] Length = 701 Score = 77.4 bits (189), Expect = 3e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLIAM+TKREIVVRD SRFH F++ CSCGDYW Sbjct: 663 DCHNAIKLIAMITKREIVVRDGSRFHRFKNSTCSCGDYW 701 >gb|KHN13611.1| Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] Length = 382 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCH+AIKLIAMVT+REIVVRDAS+FHHFR+ +CSC DYW Sbjct: 318 DCHSAIKLIAMVTRREIVVRDASKFHHFRNGSCSCSDYW 356 >ref|XP_010037424.1| PREDICTED: pentatricopeptide repeat-containing protein At5g50390, chloroplastic [Eucalyptus grandis] Length = 699 Score = 77.0 bits (188), Expect = 4e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLI + T+REIV RDASRFHHF+D +CSCGDYW Sbjct: 661 DCHNAIKLITLATRREIVFRDASRFHHFKDGSCSCGDYW 699 >gb|KCW49141.1| hypothetical protein EUGRSUZ_K02731 [Eucalyptus grandis] Length = 689 Score = 77.0 bits (188), Expect = 4e-12 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = +3 Query: 3 DCHNAIKLIAMVTKREIVVRDASRFHHFRDDNCSCGDYW 119 DCHNAIKLI + T+REIV RDASRFHHF+D +CSCGDYW Sbjct: 651 DCHNAIKLITLATRREIVFRDASRFHHFKDGSCSCGDYW 689