BLASTX nr result
ID: Forsythia21_contig00039194
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00039194 (233 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008348733.1| PREDICTED: uncharacterized protein LOC103411... 48 5e-07 ref|XP_008223145.1| PREDICTED: uncharacterized protein LOC103322... 46 1e-06 >ref|XP_008348733.1| PREDICTED: uncharacterized protein LOC103411898, partial [Malus domestica] Length = 897 Score = 47.8 bits (112), Expect(2) = 5e-07 Identities = 24/50 (48%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = -3 Query: 147 MEDLTTKKTIGLGRQSNGLYYLSQRPQI---HHTAIGSTNL*HRLLGHPS 7 ++D+ T++TIGLG++ NGLYYL+ + HH + ST L H+ LGHPS Sbjct: 418 IQDMDTRRTIGLGKRYNGLYYLAPEQNLRLAHHISRNST-LWHQRLGHPS 466 Score = 32.3 bits (72), Expect(2) = 5e-07 Identities = 15/32 (46%), Positives = 24/32 (75%), Gaps = 1/32 (3%) Frame = -2 Query: 232 DSGATDHMTKNG-IIENKSMPKHKTVQLPDGG 140 DSGATDH++ + +++ KS+ +VQLP+GG Sbjct: 377 DSGATDHVSPSPHLLDKKSLSMLDSVQLPNGG 408 >ref|XP_008223145.1| PREDICTED: uncharacterized protein LOC103322965 [Prunus mume] Length = 1031 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 23/49 (46%), Positives = 33/49 (67%), Gaps = 2/49 (4%) Frame = -3 Query: 147 MEDLTTKKTIGLGRQSNGLYYL--SQRPQIHHTAIGSTNL*HRLLGHPS 7 + D+ TKKTIGLG+ +GLYYL +Q P + +++L H+ LGHPS Sbjct: 433 LSDVDTKKTIGLGKHFDGLYYLTPAQNPHLISHVRRTSDLWHQRLGHPS 481 Score = 32.7 bits (73), Expect(2) = 1e-06 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = -2 Query: 232 DSGATDHMTKNGIIENKSMPKHKTVQLPDG 143 DSGATDH++ + N + P H+ V LP+G Sbjct: 371 DSGATDHISHSPPTHNHTTPHHEFVGLPNG 400