BLASTX nr result
ID: Forsythia21_contig00038954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038954 (220 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07550.1| unnamed protein product [Coffea canephora] 135 8e-30 ref|XP_004487374.1| PREDICTED: SPX and EXS domain-containing pro... 131 2e-28 gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] 129 6e-28 ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing pro... 129 6e-28 ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing pro... 129 6e-28 ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing pro... 129 6e-28 ref|XP_010035611.1| PREDICTED: SPX and EXS domain-containing pro... 129 8e-28 ref|XP_010035609.1| PREDICTED: SPX and EXS domain-containing pro... 129 8e-28 gb|KCW47059.1| hypothetical protein EUGRSUZ_K00863 [Eucalyptus g... 129 8e-28 ref|XP_008230104.1| PREDICTED: SPX and EXS domain-containing pro... 129 1e-27 ref|XP_008230103.1| PREDICTED: SPX and EXS domain-containing pro... 129 1e-27 ref|XP_008230102.1| PREDICTED: SPX and EXS domain-containing pro... 129 1e-27 ref|XP_007215430.1| hypothetical protein PRUPE_ppa006141mg [Prun... 129 1e-27 ref|XP_011083720.1| PREDICTED: SPX and EXS domain-containing pro... 126 5e-27 ref|XP_010109539.1| SPX and EXS domain-containing protein 1 [Mor... 125 1e-26 gb|KHN36554.1| SPX and EXS domain-containing protein 1 [Glycine ... 125 1e-26 ref|XP_006594887.1| PREDICTED: SPX and EXS domain-containing pro... 125 1e-26 ref|XP_003543379.1| PREDICTED: SPX and EXS domain-containing pro... 125 1e-26 ref|XP_011463120.1| PREDICTED: SPX and EXS domain-containing pro... 124 2e-26 ref|XP_011463115.1| PREDICTED: SPX and EXS domain-containing pro... 124 2e-26 >emb|CDP07550.1| unnamed protein product [Coffea canephora] Length = 520 Score = 135 bits (341), Expect = 8e-30 Identities = 63/72 (87%), Positives = 68/72 (94%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNYITVFTITALE++RRFQW FFRVENEWNKMNSK+N +L M Sbjct: 443 SNLILRCTWTYKLSAHLRHNYITVFTITALEIVRRFQWVFFRVENEWNKMNSKSNIELSM 502 Query: 38 SEMANEEEKLLN 3 SE+ NEEEKLLN Sbjct: 503 SELPNEEEKLLN 514 >ref|XP_004487374.1| PREDICTED: SPX and EXS domain-containing protein 1 [Cicer arietinum] Length = 472 Score = 131 bits (330), Expect = 2e-28 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNL+LRCTWTYKLSAHLRHNY+TVFTI ALE+ RRFQW FFRVENEWNKMNSK++ QL M Sbjct: 395 SNLVLRCTWTYKLSAHLRHNYLTVFTIAALEIFRRFQWIFFRVENEWNKMNSKSHMQLSM 454 Query: 38 SEMANEEEKLLN 3 SEM+NEEEKLL+ Sbjct: 455 SEMSNEEEKLLH 466 >gb|KGN54722.1| hypothetical protein Csa_4G433730 [Cucumis sativus] Length = 456 Score = 129 bits (325), Expect = 6e-28 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVFTITALE+ RRFQW FFRVENEWNKMNSK+N Q+ M Sbjct: 379 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 438 Query: 38 SEMANEEEKLLN 3 S + EE+KLLN Sbjct: 439 SNLPTEEDKLLN 450 >ref|XP_008455706.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Cucumis melo] Length = 430 Score = 129 bits (325), Expect = 6e-28 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVFTITALE+ RRFQW FFRVENEWNKMNSK+N Q+ M Sbjct: 353 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 412 Query: 38 SEMANEEEKLLN 3 S + EE+KLLN Sbjct: 413 SNLPTEEDKLLN 424 >ref|XP_008455704.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] gi|659111349|ref|XP_008455705.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X1 [Cucumis melo] Length = 477 Score = 129 bits (325), Expect = 6e-28 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVFTITALE+ RRFQW FFRVENEWNKMNSK+N Q+ M Sbjct: 400 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 459 Query: 38 SEMANEEEKLLN 3 S + EE+KLLN Sbjct: 460 SNLPTEEDKLLN 471 >ref|XP_004144336.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Cucumis sativus] Length = 477 Score = 129 bits (325), Expect = 6e-28 Identities = 59/72 (81%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVFTITALE+ RRFQW FFRVENEWNKMNSK+N Q+ M Sbjct: 400 SNLILRCTWTYKLSAHLRHNYLTVFTITALEIFRRFQWIFFRVENEWNKMNSKSNIQITM 459 Query: 38 SEMANEEEKLLN 3 S + EE+KLLN Sbjct: 460 SNLPTEEDKLLN 471 >ref|XP_010035611.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Eucalyptus grandis] Length = 433 Score = 129 bits (324), Expect = 8e-28 Identities = 60/72 (83%), Positives = 66/72 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+T+FTITALEMLRRFQWAFFRVENEWNKMNSK+ QL Sbjct: 356 SNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSGIQLST 415 Query: 38 SEMANEEEKLLN 3 E+ NEE+KLL+ Sbjct: 416 IEIGNEEDKLLS 427 >ref|XP_010035609.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Eucalyptus grandis] Length = 472 Score = 129 bits (324), Expect = 8e-28 Identities = 60/72 (83%), Positives = 66/72 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+T+FTITALEMLRRFQWAFFRVENEWNKMNSK+ QL Sbjct: 395 SNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSGIQLST 454 Query: 38 SEMANEEEKLLN 3 E+ NEE+KLL+ Sbjct: 455 IEIGNEEDKLLS 466 >gb|KCW47059.1| hypothetical protein EUGRSUZ_K00863 [Eucalyptus grandis] Length = 483 Score = 129 bits (324), Expect = 8e-28 Identities = 60/72 (83%), Positives = 66/72 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+T+FTITALEMLRRFQWAFFRVENEWNKMNSK+ QL Sbjct: 406 SNLILRCTWTYKLSAHLRHNYLTLFTITALEMLRRFQWAFFRVENEWNKMNSKSGIQLST 465 Query: 38 SEMANEEEKLLN 3 E+ NEE+KLL+ Sbjct: 466 IEIGNEEDKLLS 477 >ref|XP_008230104.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X3 [Prunus mume] Length = 441 Score = 129 bits (323), Expect = 1e-27 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLS+HLRHNY+TVF ITALE+ RRFQW FFRVENEWNKMNSK+N QL M Sbjct: 364 SNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 423 Query: 38 SEMANEEEKLL 6 S+ ANEEE+LL Sbjct: 424 SDTANEEERLL 434 >ref|XP_008230103.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Prunus mume] Length = 464 Score = 129 bits (323), Expect = 1e-27 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLS+HLRHNY+TVF ITALE+ RRFQW FFRVENEWNKMNSK+N QL M Sbjct: 387 SNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 446 Query: 38 SEMANEEEKLL 6 S+ ANEEE+LL Sbjct: 447 SDTANEEERLL 457 >ref|XP_008230102.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Prunus mume] Length = 473 Score = 129 bits (323), Expect = 1e-27 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLS+HLRHNY+TVF ITALE+ RRFQW FFRVENEWNKMNSK+N QL M Sbjct: 396 SNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 455 Query: 38 SEMANEEEKLL 6 S+ ANEEE+LL Sbjct: 456 SDTANEEERLL 466 >ref|XP_007215430.1| hypothetical protein PRUPE_ppa006141mg [Prunus persica] gi|462411580|gb|EMJ16629.1| hypothetical protein PRUPE_ppa006141mg [Prunus persica] Length = 425 Score = 129 bits (323), Expect = 1e-27 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLS+HLRHNY+TVF ITALE+ RRFQW FFRVENEWNKMNSK+N QL M Sbjct: 348 SNLILRCTWTYKLSSHLRHNYLTVFAITALEIFRRFQWVFFRVENEWNKMNSKSNIQLSM 407 Query: 38 SEMANEEEKLL 6 S+ ANEEE+LL Sbjct: 408 SDTANEEERLL 418 >ref|XP_011083720.1| PREDICTED: SPX and EXS domain-containing protein 1-like [Sesamum indicum] Length = 472 Score = 126 bits (317), Expect = 5e-27 Identities = 60/72 (83%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVFTITALEMLRRFQW FFRVENEWNKMN K+N QL M Sbjct: 396 SNLILRCTWTYKLSAHLRHNYLTVFTITALEMLRRFQWVFFRVENEWNKMN-KSNIQLAM 454 Query: 38 SEMANEEEKLLN 3 ++ EE+KLLN Sbjct: 455 MDLPKEEDKLLN 466 >ref|XP_010109539.1| SPX and EXS domain-containing protein 1 [Morus notabilis] gi|587936299|gb|EXC23143.1| SPX and EXS domain-containing protein 1 [Morus notabilis] Length = 404 Score = 125 bits (313), Expect = 1e-26 Identities = 59/71 (83%), Positives = 64/71 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+T+FTITALE+ RRFQW FFRVENE NKMNSK+N QL M Sbjct: 327 SNLILRCTWTYKLSAHLRHNYLTLFTITALEIFRRFQWVFFRVENELNKMNSKSNIQLSM 386 Query: 38 SEMANEEEKLL 6 SE NEE+KLL Sbjct: 387 SETPNEEDKLL 397 >gb|KHN36554.1| SPX and EXS domain-containing protein 1 [Glycine soja] Length = 433 Score = 125 bits (313), Expect = 1e-26 Identities = 55/72 (76%), Positives = 67/72 (93%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNL+LRCTWTYKLSAHLRHNY+TVF I ALE+ RRFQW FFRVENEWNKMNSK+++ LL+ Sbjct: 356 SNLVLRCTWTYKLSAHLRHNYLTVFFIAALEIFRRFQWIFFRVENEWNKMNSKSHSHLLV 415 Query: 38 SEMANEEEKLLN 3 +E++N+EEKLL+ Sbjct: 416 NEISNDEEKLLH 427 >ref|XP_006594887.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X5 [Glycine max] Length = 435 Score = 125 bits (313), Expect = 1e-26 Identities = 55/72 (76%), Positives = 67/72 (93%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNL+LRCTWTYKLSAHLRHNY+TVF I ALE+ RRFQW FFRVENEWNKMNSK+++ LL+ Sbjct: 358 SNLVLRCTWTYKLSAHLRHNYLTVFFIAALEIFRRFQWIFFRVENEWNKMNSKSHSHLLV 417 Query: 38 SEMANEEEKLLN 3 +E++N+EEKLL+ Sbjct: 418 NEISNDEEKLLH 429 >ref|XP_003543379.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X1 [Glycine max] gi|571501984|ref|XP_006594884.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X2 [Glycine max] gi|571501989|ref|XP_006594885.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X3 [Glycine max] gi|571501992|ref|XP_006594886.1| PREDICTED: SPX and EXS domain-containing protein 1-like isoform X4 [Glycine max] Length = 471 Score = 125 bits (313), Expect = 1e-26 Identities = 55/72 (76%), Positives = 67/72 (93%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNL+LRCTWTYKLSAHLRHNY+TVF I ALE+ RRFQW FFRVENEWNKMNSK+++ LL+ Sbjct: 394 SNLVLRCTWTYKLSAHLRHNYLTVFFIAALEIFRRFQWIFFRVENEWNKMNSKSHSHLLV 453 Query: 38 SEMANEEEKLLN 3 +E++N+EEKLL+ Sbjct: 454 NEISNDEEKLLH 465 >ref|XP_011463120.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X3 [Fragaria vesca subsp. vesca] Length = 425 Score = 124 bits (312), Expect = 2e-26 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVF ITALE+ RRFQW FFRVENEW KM+SK+N QL M Sbjct: 348 SNLILRCTWTYKLSAHLRHNYLTVFAITALEIFRRFQWVFFRVENEWIKMSSKSNFQLSM 407 Query: 38 SEMANEEEKLLN 3 S++ NEE++LLN Sbjct: 408 SDIPNEEDRLLN 419 >ref|XP_011463115.1| PREDICTED: SPX and EXS domain-containing protein 1 isoform X2 [Fragaria vesca subsp. vesca] Length = 473 Score = 124 bits (312), Expect = 2e-26 Identities = 57/72 (79%), Positives = 65/72 (90%) Frame = -3 Query: 218 SNLILRCTWTYKLSAHLRHNYITVFTITALEMLRRFQWAFFRVENEWNKMNSKANNQLLM 39 SNLILRCTWTYKLSAHLRHNY+TVF ITALE+ RRFQW FFRVENEW KM+SK+N QL M Sbjct: 396 SNLILRCTWTYKLSAHLRHNYLTVFAITALEIFRRFQWVFFRVENEWIKMSSKSNFQLSM 455 Query: 38 SEMANEEEKLLN 3 S++ NEE++LLN Sbjct: 456 SDIPNEEDRLLN 467