BLASTX nr result
ID: Forsythia21_contig00038950
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038950 (430 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97564.1| unnamed protein product [Coffea canephora] 58 3e-06 ref|XP_011073442.1| PREDICTED: probable inactive tRNA-specific a... 57 6e-06 >emb|CDO97564.1| unnamed protein product [Coffea canephora] Length = 443 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/38 (65%), Positives = 32/38 (84%) Frame = -1 Query: 430 VHRLQGEKSLNHHYAVFRVLIPVDVLKSEALFAITAEN 317 VHRLQGE+SLNHHYAVFRVL+P +++K E L +I + N Sbjct: 401 VHRLQGERSLNHHYAVFRVLLPEEMVKDETLVSIISNN 438 >ref|XP_011073442.1| PREDICTED: probable inactive tRNA-specific adenosine deaminase-like protein 3 [Sesamum indicum] Length = 417 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 430 VHRLQGEKSLNHHYAVFRVLIPVDVLKSEAL 338 VHRLQGE+SLNHHYAVFRV +P ++LKSEAL Sbjct: 380 VHRLQGERSLNHHYAVFRVSLPEEILKSEAL 410