BLASTX nr result
ID: Forsythia21_contig00038894
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038894 (280 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524580.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 ref|XP_006469372.1| PREDICTED: uncharacterized protein At4g08330... 58 3e-06 ref|XP_010090747.1| hypothetical protein L484_013769 [Morus nota... 57 6e-06 ref|XP_008800694.1| PREDICTED: uncharacterized protein At4g08330... 57 6e-06 >ref|XP_002524580.1| conserved hypothetical protein [Ricinus communis] gi|223536133|gb|EEF37788.1| conserved hypothetical protein [Ricinus communis] Length = 122 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/50 (58%), Positives = 33/50 (66%) Frame = -2 Query: 150 MSEADVFYSCGSCGYPLNLASSNRVTXXXXXXXXXXXXXXXXSFLSIDLS 1 MS+ADV YSCGSCGYPLNL+SSNR+T SFLS+DLS Sbjct: 1 MSQADVSYSCGSCGYPLNLSSSNRITSSIDSEYRKSIKKGYISFLSVDLS 50 >ref|XP_006469372.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Citrus sinensis] Length = 125 Score = 57.8 bits (138), Expect = 3e-06 Identities = 30/50 (60%), Positives = 32/50 (64%) Frame = -2 Query: 150 MSEADVFYSCGSCGYPLNLASSNRVTXXXXXXXXXXXXXXXXSFLSIDLS 1 MS+ADV YSCGSCGYPLNL SSNR+T SFLSIDLS Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSGIGSEYQKSIKKGFISFLSIDLS 50 >ref|XP_010090747.1| hypothetical protein L484_013769 [Morus notabilis] gi|587850280|gb|EXB40466.1| hypothetical protein L484_013769 [Morus notabilis] Length = 493 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = -2 Query: 150 MSEADVFYSCGSCGYPLNLASSNRVTXXXXXXXXXXXXXXXXSFLSIDLS 1 MS+ADV YSCGSCGYPLNL SSNR+T SF+S+DLS Sbjct: 1 MSQADVSYSCGSCGYPLNLTSSNRITSGIDSEYRKSIKKGLISFISVDLS 50 >ref|XP_008800694.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like [Phoenix dactylifera] Length = 120 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/50 (56%), Positives = 32/50 (64%) Frame = -2 Query: 150 MSEADVFYSCGSCGYPLNLASSNRVTXXXXXXXXXXXXXXXXSFLSIDLS 1 MS+ADV YSCGSCGYPLNL SSNR+T SF+S+DLS Sbjct: 1 MSQADVAYSCGSCGYPLNLTSSNRITSGIGSDYQKSIKKGVISFISVDLS 50