BLASTX nr result
ID: Forsythia21_contig00038829
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038829 (319 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004733034.1| cytochrome c oxidase subunit I (mitochondrio... 80 7e-13 gb|AJD79480.1| cytochrome oxidase subunit 1, partial (mitochondr... 79 2e-12 ref|YP_008964972.1| cytochrome c oxidase subunit 1 (mitochondrio... 79 2e-12 ref|YP_008965386.1| Cox1 (mitochondrion) [Rhynchosporium orthosp... 77 6e-12 ref|YP_008965340.1| Cox1 (mitochondrion) [Rhynchosporium commune... 77 6e-12 ref|YP_008965293.1| Cox1 (mitochondrion) [Rhynchosporium agropyr... 77 6e-12 ref|YP_009154285.1| cytochrome c oxidase subunit 1 (mitochondrio... 76 8e-12 ref|YP_009072327.1| cytochrome c oxidase subunit 1 (mitochondrio... 75 2e-11 gb|AGN49004.1| cytochrome c oxidase subunit 1 (mitochondrion) (m... 75 2e-11 gb|AGN74495.1| cytochrome c oxidase subunit I (mitochondrion) [G... 74 4e-11 ref|YP_001648742.1| cytochrome oxidase subunit 1 [Zymoseptoria t... 73 8e-11 emb|CAA25491.1| unnamed protein product [Podospora anserina] 72 1e-10 gb|AAA32001.2| cytochrome oxidase subunit 1 [Podospora anserina] 72 1e-10 prf||1703265A cytochrome oxidase I 72 1e-10 ref|NP_074924.1| cytochrome c oxidase subunit 1 [Podospora anser... 72 1e-10 ref|YP_002970835.1| cytochrome oxidase subunit 1 [Arthroderma un... 72 1e-10 ref|YP_313625.1| cytochrome oxidase subunit I (mitochondrion) [E... 72 1e-10 ref|YP_005351217.1| cytochrome c oxidase subunit 1 (mitochondrio... 71 2e-10 ref|YP_002970891.1| cytochrome oxidase subunit 1 [Microsporum ca... 71 3e-10 ref|YP_002970863.1| cytochrome oxidase subunit 1 [Arthroderma ob... 71 3e-10 >ref|YP_004733034.1| cytochrome c oxidase subunit I (mitochondrion) [Phialocephala subalpina] gi|336326758|gb|AEI52984.1| cytochrome oxidase subunit 1 (mitochondrion) [Phialocephala subalpina] Length = 573 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQSLLNR+Y+SLE LNSPPKPH+FVSLPLQS Sbjct: 520 SRYPWLTPQFYSDSLQSLLNRSYNSLEWALNSPPKPHAFVSLPLQS 565 >gb|AJD79480.1| cytochrome oxidase subunit 1, partial (mitochondrion) [Phialocephala sp. SA-2014] Length = 562 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQ+LLNR+Y+SLE LNSPPKPH+FVSLPLQS Sbjct: 514 SRYPWLTPQFYSDSLQTLLNRSYNSLEWALNSPPKPHAFVSLPLQS 559 >ref|YP_008964972.1| cytochrome c oxidase subunit 1 (mitochondrion) [Annulohypoxylon stygium] gi|562745123|gb|AHB33531.1| cytochrome c oxidase subunit 1 (mitochondrion) [Annulohypoxylon stygium] Length = 504 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP +TPQFYTD LQ+LLNR+Y SLE LNSPPKPH+FVSLPLQS Sbjct: 454 SRYPWMTPQFYTDTLQALLNRSYPSLEWALNSPPKPHAFVSLPLQS 499 >ref|YP_008965386.1| Cox1 (mitochondrion) [Rhynchosporium orthosporum] gi|564736911|gb|AHC02383.1| Cox1 (mitochondrion) [Rhynchosporium orthosporum] Length = 583 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQ+LLNR+Y+SLE L+SPPKPH+FVSLPLQS Sbjct: 418 SRYPWLTPQFYSDSLQTLLNRSYNSLEWALSSPPKPHAFVSLPLQS 463 >ref|YP_008965340.1| Cox1 (mitochondrion) [Rhynchosporium commune] gi|564736864|gb|AHC02337.1| Cox1 (mitochondrion) [Rhynchosporium commune] Length = 583 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQ+LLNR+Y+SLE L+SPPKPH+FVSLPLQS Sbjct: 418 SRYPWLTPQFYSDSLQTLLNRSYNSLEWALSSPPKPHAFVSLPLQS 463 >ref|YP_008965293.1| Cox1 (mitochondrion) [Rhynchosporium agropyri] gi|568192670|ref|YP_008965413.1| Cox1 (mitochondrion) [Rhynchosporium secalis] gi|564736816|gb|AHC02290.1| Cox1 (mitochondrion) [Rhynchosporium agropyri] gi|564736939|gb|AHC02410.1| Cox1 (mitochondrion) [Rhynchosporium secalis] Length = 583 Score = 76.6 bits (187), Expect = 6e-12 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQ+LLNR+Y+SLE L+SPPKPH+FVSLPLQS Sbjct: 418 SRYPWLTPQFYSDSLQTLLNRSYNSLEWALSSPPKPHAFVSLPLQS 463 >ref|YP_009154285.1| cytochrome c oxidase subunit 1 (mitochondrion) [Pseudogymnoascus pannorum] gi|835483044|gb|AKM70295.1| cytochrome c oxidase subunit 1 (mitochondrion) [Pseudogymnoascus pannorum] Length = 532 Score = 76.3 bits (186), Expect = 8e-12 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQFY+D LQ+LLNR+Y+SLE L SPPKPH+FVSLPLQS Sbjct: 485 SRYPWLTPQFYSDSLQTLLNRSYNSLEWALTSPPKPHAFVSLPLQS 530 >ref|YP_009072327.1| cytochrome c oxidase subunit 1 (mitochondrion) [Sclerotinia borealis] gi|618730446|gb|AHX82991.1| cytochrome c oxidase subunit 1 (mitochondrion) [Sclerotinia borealis] Length = 690 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 +RYP LTPQFY+D LQ+LLNR+Y+SLE L SPPKPH+FVSLPLQS Sbjct: 540 TRYPWLTPQFYSDSLQTLLNRSYNSLEWALTSPPKPHAFVSLPLQS 585 >gb|AGN49004.1| cytochrome c oxidase subunit 1 (mitochondrion) (mitochondrion) [Botrytis cinerea B05.10] Length = 606 Score = 75.1 bits (183), Expect = 2e-11 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 +RYP LTPQFY+D LQ+LLNR+Y+SLE L SPPKPH+FVSLPLQS Sbjct: 559 TRYPWLTPQFYSDSLQTLLNRSYNSLEWALTSPPKPHAFVSLPLQS 604 >gb|AGN74495.1| cytochrome c oxidase subunit I (mitochondrion) [Glarea lozoyensis 74030] Length = 595 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 +RYP LTPQFYTD+LQ LLNR+ +SLE L+SPPKPH+FVSLPLQS Sbjct: 526 ARYPWLTPQFYTDHLQVLLNRSSNSLEWALSSPPKPHAFVSLPLQS 571 >ref|YP_001648742.1| cytochrome oxidase subunit 1 [Zymoseptoria tritici] gi|155964391|gb|ABU40258.1| cytochrome oxidase subunit 1 (mitochondrion) [Zymoseptoria tritici] Length = 669 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP PQF++DYL+ LLNRA+ SLE CLNSPPKPH+F SLP+QS Sbjct: 483 SRYPWAIPQFFSDYLRFLLNRAFLSLEWCLNSPPKPHAFASLPVQS 528 >emb|CAA25491.1| unnamed protein product [Podospora anserina] Length = 161 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 316 RYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 R+P L PQFYTD LQ+LLNR+Y SLE L+SPPKPH+FVSLPLQS Sbjct: 110 RFPWLNPQFYTDTLQALLNRSYPSLEWALSSPPKPHAFVSLPLQS 154 >gb|AAA32001.2| cytochrome oxidase subunit 1 [Podospora anserina] Length = 166 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 316 RYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 R+P L PQFYTD LQ+LLNR+Y SLE L+SPPKPH+FVSLPLQS Sbjct: 115 RFPWLNPQFYTDTLQALLNRSYPSLEWALSSPPKPHAFVSLPLQS 159 >prf||1703265A cytochrome oxidase I Length = 541 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 316 RYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 R+P L PQFYTD LQ+LLNR+Y SLE L+SPPKPH+FVSLPLQS Sbjct: 490 RFPWLNPQFYTDTLQALLNRSYPSLEWALSSPPKPHAFVSLPLQS 534 >ref|NP_074924.1| cytochrome c oxidase subunit 1 [Podospora anserina] gi|399282|sp|P20681.2|COX1_PODAN RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I (mitochondrion) [Podospora anserina S mat+] gi|2673848|emb|CAA38777.1| cytochrome oxidase c [Podospora anserina] Length = 541 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -1 Query: 316 RYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 R+P L PQFYTD LQ+LLNR+Y SLE L+SPPKPH+FVSLPLQS Sbjct: 490 RFPWLNPQFYTDTLQALLNRSYPSLEWALSSPPKPHAFVSLPLQS 534 >ref|YP_002970835.1| cytochrome oxidase subunit 1 [Arthroderma uncinatum] gi|237781103|gb|ACR19595.1| cytochrome oxidase subunit 1 [Arthroderma uncinatum] Length = 528 Score = 72.4 bits (176), Expect = 1e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQ+++D Q+L NR SSLE CLNSPPKPH+FVSLP+QS Sbjct: 483 SRYPWLTPQYFSDLFQTLFNRNNSSLEWCLNSPPKPHAFVSLPIQS 528 >ref|YP_313625.1| cytochrome oxidase subunit I (mitochondrion) [Epidermophyton floccosum] gi|58429669|gb|AAW78231.1| cytochrome oxidase subunit I (mitochondrion) [Epidermophyton floccosum] Length = 528 Score = 72.0 bits (175), Expect = 1e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQ+++D Q+L NR SSLE CLNSPPKPH+FVSLP+QS Sbjct: 483 SRYPWLTPQYFSDLFQTLFNRNNSSLEWCLNSPPKPHAFVSLPVQS 528 >ref|YP_005351217.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera membranacea] gi|340536560|gb|AEK48332.1| cytochrome c oxidase subunit 1 (mitochondrion) [Peltigera membranacea] Length = 631 Score = 71.2 bits (173), Expect = 2e-10 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LT F D LQSLL RAY+SLE CLNSPPKPH+F+SLP+QS Sbjct: 508 SRYPWLTVPFNVDTLQSLLTRAYNSLEWCLNSPPKPHAFISLPIQS 553 >ref|YP_002970891.1| cytochrome oxidase subunit 1 [Microsporum canis] gi|237781140|gb|ACR19630.1| cytochrome oxidase subunit 1 [Arthroderma otae] Length = 528 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQ+++D Q+L NR +SLE CLNSPPKPH+FVSLP+QS Sbjct: 483 SRYPWLTPQYFSDLFQTLFNRNNNSLEWCLNSPPKPHAFVSLPVQS 528 >ref|YP_002970863.1| cytochrome oxidase subunit 1 [Arthroderma obtusum] gi|237781118|gb|ACR19609.1| cytochrome oxidase subunit 1 [Arthroderma obtusum] Length = 528 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -1 Query: 319 SRYP*LTPQFYTDYLQSLLNRAYSSLE*CLNSPPKPHSFVSLPLQS 182 SRYP LTPQ+++D Q+L NR +SLE CLNSPPKPH+FVSLP+QS Sbjct: 483 SRYPWLTPQYFSDLFQTLFNRNNNSLEWCLNSPPKPHAFVSLPVQS 528