BLASTX nr result
ID: Forsythia21_contig00038814
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038814 (420 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_001804952.1| hypothetical protein SNOG_14769 [Phaeosphaer... 132 7e-29 gb|EUN24236.1| hypothetical protein COCVIDRAFT_106678 [Bipolaris... 130 3e-28 ref|XP_007691341.1| hypothetical protein COCMIDRAFT_8246 [Bipola... 130 3e-28 ref|XP_008021975.1| hypothetical protein SETTUDRAFT_166997 [Seto... 129 6e-28 ref|XP_003835087.1| hypothetical protein LEMA_P072300.1 [Leptosp... 128 1e-27 ref|XP_003301025.1| hypothetical protein PTT_12424 [Pyrenophora ... 125 1e-26 ref|XP_001930521.1| conserved hypothetical protein [Pyrenophora ... 122 7e-26 ref|XP_007778819.1| hypothetical protein W97_02730 [Coniosporium... 95 2e-17 gb|KIV99808.1| hypothetical protein PV09_08612 [Verruconis gallo... 90 7e-16 gb|EKG17343.1| ATPase F0 complex subunit 8 mitochondrial fungal ... 77 3e-12 gb|KKY21753.1| putative atp synthase f0 subunit 8 [Diplodia seri... 75 1e-11 ref|YP_001648759.1| ATP synthase subunit 8 [Zymoseptoria tritici... 75 2e-11 ref|YP_004733040.1| ATP synthase F0 subunit 8 (mitochondrion) [P... 74 4e-11 ref|YP_009154287.1| ATP synthase F0 subunit 8 (mitochondrion) [P... 74 5e-11 ref|YP_009072361.1| ATP synthase subunit 8 (mitochondrion) [Scle... 73 6e-11 ref|XP_007579813.1| putative atp synthase subunit 8 protein [Neo... 73 6e-11 ref|YP_008965395.1| Atp8 (mitochondrion) [Rhynchosporium orthosp... 70 4e-10 ref|YP_008965315.1| Atp8 (mitochondrion) [Rhynchosporium agropyr... 70 4e-10 ref|YP_005351189.1| ATP synthase F0 subunit 8 (mitochondrion) [P... 70 5e-10 ref|YP_337881.1| ATP synthase subunit 8 [Aspergillus niger] gi|8... 69 1e-09 >ref|XP_001804952.1| hypothetical protein SNOG_14769 [Phaeosphaeria nodorum SN15] gi|111056841|gb|EAT77961.1| hypothetical protein SNOG_14769 [Phaeosphaeria nodorum SN15] Length = 99 Score = 132 bits (333), Expect = 7e-29 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+ASQ+KKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIY+FSKYILPQRVRL Sbjct: 30 LVASQSKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYIFSKYILPQRVRL 89 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 90 FAARLFISKL 99 >gb|EUN24236.1| hypothetical protein COCVIDRAFT_106678 [Bipolaris victoriae FI3] Length = 99 Score = 130 bits (327), Expect = 3e-28 Identities = 67/70 (95%), Positives = 68/70 (97%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+ASQ KKTEV PQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL Sbjct: 30 LVASQTKKTEVSPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 89 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 90 FAARLFISKL 99 >ref|XP_007691341.1| hypothetical protein COCMIDRAFT_8246 [Bipolaris oryzae ATCC 44560] gi|628083618|ref|XP_007703659.1| hypothetical protein COCSADRAFT_40300 [Bipolaris sorokiniana ND90Pr] gi|628204361|ref|XP_007711643.1| hypothetical protein COCCADRAFT_94477 [Bipolaris zeicola 26-R-13] gi|451847381|gb|EMD60689.1| hypothetical protein COCSADRAFT_40300 [Bipolaris sorokiniana ND90Pr] gi|451992804|gb|EMD85282.1| hypothetical protein COCHEDRAFT_1188511 [Bipolaris maydis C5] gi|477582416|gb|ENH99525.1| hypothetical protein COCC4DRAFT_207965 [Bipolaris maydis ATCC 48331] gi|576919881|gb|EUC34047.1| hypothetical protein COCCADRAFT_94477 [Bipolaris zeicola 26-R-13] gi|576928485|gb|EUC42125.1| hypothetical protein COCMIDRAFT_8246 [Bipolaris oryzae ATCC 44560] Length = 99 Score = 130 bits (327), Expect = 3e-28 Identities = 67/70 (95%), Positives = 68/70 (97%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+ASQ KKTEV PQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL Sbjct: 30 LVASQTKKTEVSPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 89 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 90 FAARLFISKL 99 >ref|XP_008021975.1| hypothetical protein SETTUDRAFT_166997 [Setosphaeria turcica Et28A] gi|482813343|gb|EOA90034.1| hypothetical protein SETTUDRAFT_166997 [Setosphaeria turcica Et28A] Length = 99 Score = 129 bits (325), Expect = 6e-28 Identities = 65/70 (92%), Positives = 68/70 (97%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L ASQNKK+EV PQQMTVLKSAMPQLIPFFFVNETTVAF+LLPSLIY+FSKYILPQRVRL Sbjct: 30 LAASQNKKSEVSPQQMTVLKSAMPQLIPFFFVNETTVAFVLLPSLIYIFSKYILPQRVRL 89 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 90 FAARLFISKL 99 >ref|XP_003835087.1| hypothetical protein LEMA_P072300.1 [Leptosphaeria maculans JN3] gi|312211637|emb|CBX91722.1| hypothetical protein LEMA_P072300.1 [Leptosphaeria maculans JN3] Length = 147 Score = 128 bits (322), Expect = 1e-27 Identities = 66/70 (94%), Positives = 67/70 (95%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+ASQ KK EVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILP RVRL Sbjct: 78 LVASQTKKPEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPNRVRL 137 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 138 FAARLFISKL 147 >ref|XP_003301025.1| hypothetical protein PTT_12424 [Pyrenophora teres f. teres 0-1] gi|311324588|gb|EFQ90897.1| hypothetical protein PTT_12424 [Pyrenophora teres f. teres 0-1] Length = 100 Score = 125 bits (314), Expect = 1e-26 Identities = 62/70 (88%), Positives = 67/70 (95%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+A+QNKK EVG QQMTVLKSAMPQLIPFFFVNETTVAF+LLP LIY+FSKYILPQR+RL Sbjct: 31 LIANQNKKPEVGTQQMTVLKSAMPQLIPFFFVNETTVAFVLLPGLIYIFSKYILPQRLRL 90 Query: 123 FAARLFISKL 94 FAARLFISKL Sbjct: 91 FAARLFISKL 100 >ref|XP_001930521.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187972127|gb|EDU39626.1| conserved hypothetical protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 120 Score = 122 bits (307), Expect = 7e-26 Identities = 61/69 (88%), Positives = 65/69 (94%) Frame = -1 Query: 303 LLASQNKKTEVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRL 124 L+A+QNKK EVG QQMT LKSAMPQLIPFFFVNETTVAFILLP LIY+FSKYILPQR+RL Sbjct: 31 LIANQNKKPEVGAQQMTALKSAMPQLIPFFFVNETTVAFILLPGLIYIFSKYILPQRLRL 90 Query: 123 FAARLFISK 97 FAARLFISK Sbjct: 91 FAARLFISK 99 >ref|XP_007778819.1| hypothetical protein W97_02730 [Coniosporium apollinis CBS 100218] gi|494826420|gb|EON63502.1| hypothetical protein W97_02730 [Coniosporium apollinis CBS 100218] Length = 130 Score = 94.7 bits (234), Expect = 2e-17 Identities = 45/58 (77%), Positives = 52/58 (89%) Frame = -1 Query: 267 PQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 P M L++AMPQLIPFFFVNET +AF+LLP+L+Y+FSKYILPQRVRL AARLFISKL Sbjct: 73 PTSMIPLQAAMPQLIPFFFVNETIIAFVLLPTLVYMFSKYILPQRVRLMAARLFISKL 130 >gb|KIV99808.1| hypothetical protein PV09_08612 [Verruconis gallopava] Length = 106 Score = 89.7 bits (221), Expect = 7e-16 Identities = 44/68 (64%), Positives = 54/68 (79%), Gaps = 2/68 (2%) Frame = -1 Query: 291 QNKKTEVG--PQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFA 118 Q KK G +M +L++AMPQLIPF+FVNE T AFI++P+LIY+FSKY+LPQRVR Sbjct: 39 QTKKNTNGLPADKMRILQAAMPQLIPFYFVNEVTTAFIIMPTLIYIFSKYLLPQRVRTMC 98 Query: 117 ARLFISKL 94 ARLFISKL Sbjct: 99 ARLFISKL 106 >gb|EKG17343.1| ATPase F0 complex subunit 8 mitochondrial fungal [Macrophomina phaseolina MS6] Length = 107 Score = 77.4 bits (189), Expect = 3e-12 Identities = 35/56 (62%), Positives = 46/56 (82%) Frame = -1 Query: 261 QMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 +MT+L + MPQL+PF++VNETTVAF ++P+ +Y SKY LPQ +R AARLFISKL Sbjct: 52 KMTMLYAGMPQLVPFYWVNETTVAFAIIPTFVYFLSKYFLPQDLRRMAARLFISKL 107 >gb|KKY21753.1| putative atp synthase f0 subunit 8 [Diplodia seriata] Length = 108 Score = 75.5 bits (184), Expect = 1e-11 Identities = 34/61 (55%), Positives = 45/61 (73%) Frame = -1 Query: 276 EVGPQQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISK 97 + G + T+L + MPQL+PF++VNETT AF ++P+ +Y SKY LPQ VR ARLFISK Sbjct: 48 KAGAKMQTMLYAGMPQLVPFYWVNETTFAFAIIPTFVYFLSKYFLPQDVRRMCARLFISK 107 Query: 96 L 94 L Sbjct: 108 L 108 >ref|YP_001648759.1| ATP synthase subunit 8 [Zymoseptoria tritici] gi|155964408|gb|ABU40275.1| ATP synthase subunit 8 (mitochondrion) [Zymoseptoria tritici] Length = 48 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PFFF+N+ AF++ L+YVFSKYILP+ VRLFAARLFISKL Sbjct: 1 MPQLVPFFFINQVVFAFVIFVLLVYVFSKYILPRFVRLFAARLFISKL 48 >ref|YP_004733040.1| ATP synthase F0 subunit 8 (mitochondrion) [Phialocephala subalpina] gi|336326754|gb|AEI52980.1| ATP synthase subunit 8 (mitochondrion) [Phialocephala subalpina] Length = 48 Score = 73.9 bits (180), Expect = 4e-11 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PF+F+N+ T AFILL +IYVFSKYILP+ VRLF R+FISKL Sbjct: 1 MPQLVPFYFINQVTFAFILLVIMIYVFSKYILPRFVRLFTTRIFISKL 48 >ref|YP_009154287.1| ATP synthase F0 subunit 8 (mitochondrion) [Pseudogymnoascus pannorum] gi|835483046|gb|AKM70297.1| ATP synthase F0 subunit 8 (mitochondrion) [Pseudogymnoascus pannorum] Length = 48 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/48 (66%), Positives = 43/48 (89%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PF+F+N+ T AF++L ++IYVFSKYILP+ VRLF +R+FISKL Sbjct: 1 MPQLVPFYFINQVTFAFVILVTMIYVFSKYILPRFVRLFLSRVFISKL 48 >ref|YP_009072361.1| ATP synthase subunit 8 (mitochondrion) [Sclerotinia borealis] gi|510787224|gb|AGN49023.1| ATP synthase subunit 8 (mitochondrion) (mitochondrion) [Botrytis cinerea B05.10] gi|618730470|gb|AHX83015.1| ATP synthase subunit 8 (mitochondrion) [Sclerotinia borealis] Length = 48 Score = 73.2 bits (178), Expect = 6e-11 Identities = 34/48 (70%), Positives = 42/48 (87%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PF+F+N+ T AFILL +IYVFSKYILP+ VRLF +R+FISKL Sbjct: 1 MPQLVPFYFINQVTFAFILLIVMIYVFSKYILPRFVRLFISRVFISKL 48 >ref|XP_007579813.1| putative atp synthase subunit 8 protein [Neofusicoccum parvum UCRNP2] gi|485929290|gb|EOD52720.1| putative atp synthase subunit 8 protein [Neofusicoccum parvum UCRNP2] Length = 108 Score = 73.2 bits (178), Expect = 6e-11 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = -1 Query: 264 QQMTVLKSAMPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 + T+L + MPQL+PFF+VNETT AF ++P+ +Y SKY LPQ VR AR+FISKL Sbjct: 52 KMQTMLYAGMPQLVPFFWVNETTFAFAIIPTFVYFLSKYFLPQDVRRMCARVFISKL 108 >ref|YP_008965395.1| Atp8 (mitochondrion) [Rhynchosporium orthosporum] gi|564736937|gb|AHC02409.1| Atp8 (mitochondrion) [Rhynchosporium orthosporum] Length = 48 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PF+F+N+ T AFIL +IYVFSK+ILP+ VRLF R+FISKL Sbjct: 1 MPQLVPFYFINQVTFAFILFVVMIYVFSKFILPRFVRLFTTRVFISKL 48 >ref|YP_008965315.1| Atp8 (mitochondrion) [Rhynchosporium agropyri] gi|568192640|ref|YP_008965363.1| Atp8 (mitochondrion) [Rhynchosporium commune] gi|568192716|ref|YP_008965436.1| Atp8 (mitochondrion) [Rhynchosporium secalis] gi|564736862|gb|AHC02336.1| Atp8 (mitochondrion) [Rhynchosporium agropyri] gi|564736909|gb|AHC02382.1| Atp8 (mitochondrion) [Rhynchosporium commune] gi|564736985|gb|AHC02456.1| Atp8 (mitochondrion) [Rhynchosporium secalis] Length = 48 Score = 70.5 bits (171), Expect = 4e-10 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PF+F+N+ T AFIL +IYVFSK+ILP+ VRLF R+FISKL Sbjct: 1 MPQLVPFYFINQVTFAFILFVIMIYVFSKFILPRFVRLFTTRVFISKL 48 >ref|YP_005351189.1| ATP synthase F0 subunit 8 (mitochondrion) [Peltigera malacea] gi|340536544|gb|AEK48317.1| ATP synthase F0 subunit 8 (mitochondrion) [Peltigera malacea] Length = 48 Score = 70.1 bits (170), Expect = 5e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQLIPF+F ++ T FILL ++YVFSKYILP+ VRLF RLFISKL Sbjct: 1 MPQLIPFYFTDQVTFTFILLTVMVYVFSKYILPRFVRLFLTRLFISKL 48 >ref|YP_337881.1| ATP synthase subunit 8 [Aspergillus niger] gi|81230396|ref|YP_398772.1| ATP synthase subunit 8 [Aspergillus tubingensis] gi|45504614|gb|AAS66785.1| ATP synthase subunit 8 [Aspergillus niger] gi|75993223|gb|ABA33728.1| ATP synthase subunit 8 [Aspergillus niger] gi|77157984|gb|ABA62012.1| ATP synthase subunit 8 [Aspergillus tubingensis] gi|354548785|dbj|BAL04877.1| ATP synthase subunit 8 [Aspergillus kawachii IFO 4308] Length = 48 Score = 68.9 bits (167), Expect = 1e-09 Identities = 30/48 (62%), Positives = 40/48 (83%) Frame = -1 Query: 237 MPQLIPFFFVNETTVAFILLPSLIYVFSKYILPQRVRLFAARLFISKL 94 MPQL+PFFFVN+ AF++L LIY FSKYILP+ VR+F +R++I+KL Sbjct: 1 MPQLVPFFFVNQVVFAFVILTVLIYAFSKYILPKFVRIFISRIYINKL 48