BLASTX nr result
ID: Forsythia21_contig00038771
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038771 (264 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ83315.1| hypothetical protein M438DRAFT_275530 [Aureobasid... 60 4e-07 gb|KEQ62516.1| putative phosphatidylinositol transporter [Aureob... 60 4e-07 gb|KEQ92012.1| hypothetical protein AUEXF2481DRAFT_43410 [Aureob... 59 2e-06 gb|KEQ69573.1| hypothetical protein M436DRAFT_55882 [Aureobasidi... 59 2e-06 gb|EEQ87943.1| phosphatidylinositol-phosphatidylcholine transfer... 56 8e-06 ref|XP_002627813.1| phosphatidylinositol-phosphatidylcholine tra... 56 8e-06 >gb|KEQ83315.1| hypothetical protein M438DRAFT_275530 [Aureobasidium pullulans EXF-150] Length = 341 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 99 MAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 MA ITQDPKYD+YDFPT S N GHPGHTTPE Sbjct: 1 MASITQDPKYDHYDFPTVSNTNQSGHPGHTTPE 33 >gb|KEQ62516.1| putative phosphatidylinositol transporter [Aureobasidium melanogenum CBS 110374] Length = 340 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = -1 Query: 99 MAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 MA ITQDPKYD+YDFPT S N GHPGHTTPE Sbjct: 1 MASITQDPKYDHYDFPTVSNTNQSGHPGHTTPE 33 >gb|KEQ92012.1| hypothetical protein AUEXF2481DRAFT_43410 [Aureobasidium subglaciale EXF-2481] Length = 341 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 99 MAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 MA I QDPKYD+YDFPT S N GHPGHTTPE Sbjct: 1 MASINQDPKYDHYDFPTVSNTNQSGHPGHTTPE 33 >gb|KEQ69573.1| hypothetical protein M436DRAFT_55882 [Aureobasidium namibiae CBS 147.97] Length = 341 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = -1 Query: 99 MAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 MA I QDPKYD+YDFPT S N GHPGHTTPE Sbjct: 1 MAAIAQDPKYDHYDFPTVSNTNQSGHPGHTTPE 33 >gb|EEQ87943.1| phosphatidylinositol-phosphatidylcholine transfer protein [Blastomyces dermatitidis ER-3] Length = 363 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 153 TTSSHPFYTQLP-PTHLPIMAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 T++ P T P PT P + +T DPKYDNYDFPT +P GHPGHTTPE Sbjct: 2 TSTPTPTPTPAPAPTTTPSHS-LTLDPKYDNYDFPTTAPDAQSGHPGHTTPE 52 >ref|XP_002627813.1| phosphatidylinositol-phosphatidylcholine transfer protein [Blastomyces dermatitidis SLH14081] gi|239592872|gb|EEQ75453.1| phosphatidylinositol-phosphatidylcholine transfer protein [Blastomyces dermatitidis SLH14081] gi|327351666|gb|EGE80523.1| phosphatidylinositol-phosphatidylcholine transfer protein [Blastomyces dermatitidis ATCC 18188] Length = 364 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/52 (55%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 153 TTSSHPFYTQLP-PTHLPIMAGITQDPKYDNYDFPTQSPINLPGHPGHTTPE 1 T++ P T P PT P + +T DPKYDNYDFPT +P GHPGHTTPE Sbjct: 2 TSTPTPTPTPAPAPTTTPSHS-LTLDPKYDNYDFPTTAPDAQSGHPGHTTPE 52