BLASTX nr result
ID: Forsythia21_contig00038717
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038717 (227 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN76029.1| hypothetical protein VITISV_016069 [Vitis vinifera] 41 3e-07 emb|CAN66637.1| hypothetical protein VITISV_011340 [Vitis vinifera] 40 2e-06 >emb|CAN76029.1| hypothetical protein VITISV_016069 [Vitis vinifera] Length = 1096 Score = 40.8 bits (94), Expect(2) = 3e-07 Identities = 22/51 (43%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = -3 Query: 225 RDATYFEDVYPFKTRIPSEPSTSRNVI--LNSTPSSLSLEAEAELRRSKRV 79 R+A++FEDV+P K++ EPS+S+ ++ +N + E E E RRSKRV Sbjct: 530 RNASFFEDVFPCKSK--EEPSSSKRMLETINENSQDQNEEVEVEPRRSKRV 578 Score = 40.0 bits (92), Expect(2) = 3e-07 Identities = 15/26 (57%), Positives = 23/26 (88%) Frame = -2 Query: 79 RTEKFFGEEFFTYLVEGEPKTYKDAM 2 RTEK FG +F T+++EGEP+T+K+A+ Sbjct: 579 RTEKSFGPDFLTFMLEGEPQTFKEAV 604 >emb|CAN66637.1| hypothetical protein VITISV_011340 [Vitis vinifera] Length = 1316 Score = 40.0 bits (92), Expect(2) = 2e-06 Identities = 15/26 (57%), Positives = 23/26 (88%) Frame = -2 Query: 79 RTEKFFGEEFFTYLVEGEPKTYKDAM 2 RTEK FG +F T+++EGEP+T+K+A+ Sbjct: 796 RTEKSFGPDFLTFMLEGEPQTFKEAV 821 Score = 38.1 bits (87), Expect(2) = 2e-06 Identities = 21/49 (42%), Positives = 33/49 (67%) Frame = -3 Query: 225 RDATYFEDVYPFKTRIPSEPSTSRNVILNSTPSSLSLEAEAELRRSKRV 79 R+A++FEDV+P K++ EPS+S+ ++ + + E E E RRSKRV Sbjct: 752 RNASFFEDVFPCKSK--EEPSSSKRMLESQDQNE---EVEVEPRRSKRV 795