BLASTX nr result
ID: Forsythia21_contig00038686
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038686 (394 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323869.2| pentatricopeptide repeat-containing family p... 66 1e-08 ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 ref|XP_008230790.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prun... 61 3e-07 gb|KDO72616.1| hypothetical protein CISIN_1g000837mg [Citrus sin... 61 3e-07 ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, part... 61 3e-07 ref|XP_011085856.1| PREDICTED: pentatricopeptide repeat-containi... 60 4e-07 ref|XP_012084727.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_012084726.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_009376285.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_008379838.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 ref|XP_002533116.1| pentatricopeptide repeat-containing protein,... 58 3e-06 >ref|XP_002323869.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320105|gb|EEF04002.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 1255 Score = 65.9 bits (159), Expect = 1e-08 Identities = 32/61 (52%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTRXXXXXXXXXXXXXLKKP-NTKM 217 EL+Q+MQ++GY PDFDTHWSLISNLSN+SDKD +K+++ KK N K+ Sbjct: 1195 ELMQMMQQSGYEPDFDTHWSLISNLSNSSDKDYNKSSQGFLSSLLAGSGFSSKKDLNAKL 1254 Query: 216 G 214 G Sbjct: 1255 G 1255 >ref|XP_011035789.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Populus euphratica] Length = 1255 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/38 (65%), Positives = 36/38 (94%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 EL+Q+MQ++GY PDF+THWSLISNLSN+SDKD +++++ Sbjct: 1195 ELMQMMQQSGYEPDFETHWSLISNLSNSSDKDYNRSSQ 1232 >ref|XP_008230790.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Prunus mume] Length = 1273 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 EL+Q MQ++G+ PDF+THWSLISNLSN+SDKD + ++R Sbjct: 1213 ELMQAMQQSGFEPDFETHWSLISNLSNSSDKDNANSSR 1250 >ref|XP_007217362.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] gi|462413512|gb|EMJ18561.1| hypothetical protein PRUPE_ppa021574mg [Prunus persica] Length = 994 Score = 61.2 bits (147), Expect = 3e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 EL+Q MQ++G+ PDF+THWSLISNLSN+SDKD + ++R Sbjct: 934 ELMQAMQQSGFEPDFETHWSLISNLSNSSDKDNANSSR 971 >gb|KDO72616.1| hypothetical protein CISIN_1g000837mg [Citrus sinensis] Length = 1262 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 EL+Q MQ++GY+PDF THWSLISNL N++DKD ++N++ Sbjct: 1208 ELMQAMQQSGYSPDFSTHWSLISNLRNSNDKDNNRNSQ 1245 >ref|XP_006431198.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] gi|557533255|gb|ESR44438.1| hypothetical protein CICLE_v10013587mg, partial [Citrus clementina] Length = 1231 Score = 60.8 bits (146), Expect = 3e-07 Identities = 24/38 (63%), Positives = 34/38 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 EL+Q MQ++GY+PDF THWSLISNL N++DKD ++N++ Sbjct: 1177 ELMQAMQQSGYSPDFSTHWSLISNLRNSNDKDNNRNSQ 1214 >ref|XP_011085856.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Sesamum indicum] Length = 1247 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/59 (49%), Positives = 35/59 (59%) Frame = -2 Query: 390 LLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTRXXXXXXXXXXXXXLKKPNTKMG 214 LL++MQ+ GY PDFDTHWSLISNLSN+S KD+S K N+K G Sbjct: 1189 LLKVMQQKGYVPDFDTHWSLISNLSNSSKKDDSVRNSSFLSNLLSGFDFAQKNSNSKTG 1247 >ref|XP_012084727.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 isoform X2 [Jatropha curcas] Length = 1246 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNT 283 +L+QLMQE+GY PDFDTHWSLISNL ++ DK+ +KNT Sbjct: 1186 QLMQLMQESGYVPDFDTHWSLISNLQSSKDKN-NKNT 1221 >ref|XP_012084726.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 isoform X1 [Jatropha curcas] gi|643714811|gb|KDP27166.1| hypothetical protein JCGZ_19865 [Jatropha curcas] Length = 1273 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/37 (70%), Positives = 33/37 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNT 283 +L+QLMQE+GY PDFDTHWSLISNL ++ DK+ +KNT Sbjct: 1213 QLMQLMQESGYVPDFDTHWSLISNLQSSKDKN-NKNT 1248 >ref|XP_006482624.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280-like [Citrus sinensis] Length = 1259 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/38 (57%), Positives = 34/38 (89%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 +L+Q MQ++GY+PDF THWSLISNL N++D+D ++N++ Sbjct: 1208 DLMQAMQQSGYSPDFSTHWSLISNLRNSNDEDNNRNSQ 1245 >ref|XP_009376285.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Pyrus x bretschneideri] Length = 1266 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKN 286 EL+Q MQE+G+ PDF+THWSLISNLSN+ DKD + + Sbjct: 1211 ELMQKMQESGFEPDFETHWSLISNLSNSRDKDNTNS 1246 >ref|XP_008379838.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15280 [Malus domestica] Length = 1265 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/36 (66%), Positives = 31/36 (86%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKN 286 EL+Q MQE+G+ PDF+THWSLISNLSN+ DKD + + Sbjct: 1210 ELMQKMQESGFEPDFETHWSLISNLSNSRDKDNTNS 1245 >ref|XP_002533116.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223527079|gb|EEF29261.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1204 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -2 Query: 393 ELLQLMQENGYAPDFDTHWSLISNLSNNSDKDESKNTR 280 +L+Q+MQ NGY PDFDTHWSLISNL DKD ++ R Sbjct: 1138 QLMQMMQRNGYEPDFDTHWSLISNLQKFKDKDNNQEER 1175