BLASTX nr result
ID: Forsythia21_contig00038614
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038614 (248 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004292978.1| PREDICTED: ACT domain-containing protein ACR... 64 5e-08 ref|XP_008378393.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 63 7e-08 ref|XP_006371753.1| hypothetical protein POPTR_0018s01920g [Popu... 63 9e-08 ref|XP_002324305.2| hypothetical protein POPTR_0018s01920g [Popu... 63 9e-08 gb|ABG37643.1| unknown [Populus trichocarpa] 63 9e-08 ref|XP_011036590.1| PREDICTED: uncharacterized protein LOC105134... 62 1e-07 ref|XP_008466435.1| PREDICTED: uncharacterized protein LOC103503... 62 1e-07 ref|XP_004136481.1| PREDICTED: ACT domain-containing protein ACR... 62 1e-07 ref|XP_008219523.1| PREDICTED: uncharacterized protein LOC103319... 61 3e-07 ref|XP_008219522.1| PREDICTED: uncharacterized protein LOC103319... 61 3e-07 ref|XP_012076518.1| PREDICTED: ACT domain-containing protein ACR... 61 3e-07 ref|XP_002515490.1| amino acid binding protein, putative [Ricinu... 61 3e-07 ref|XP_011081540.1| PREDICTED: uncharacterized protein LOC105164... 60 7e-07 ref|XP_006450386.1| hypothetical protein CICLE_v10010775mg [Citr... 60 7e-07 ref|XP_011039651.1| PREDICTED: uncharacterized protein LOC105136... 59 1e-06 ref|XP_006382080.1| hypothetical protein POPTR_0006s27260g [Popu... 59 1e-06 ref|XP_007011818.1| ACT-like superfamily protein [Theobroma caca... 59 1e-06 ref|XP_010241627.1| PREDICTED: uncharacterized protein LOC104586... 58 2e-06 ref|XP_010493784.1| PREDICTED: uncharacterized protein LOC104771... 57 4e-06 ref|XP_010454854.1| PREDICTED: uncharacterized protein LOC104736... 57 4e-06 >ref|XP_004292978.1| PREDICTED: ACT domain-containing protein ACR2 [Fragaria vesca subsp. vesca] gi|764541862|ref|XP_011459167.1| PREDICTED: ACT domain-containing protein ACR2 [Fragaria vesca subsp. vesca] Length = 485 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK+VCWPY+DPDFD LPERI+GP CRV+ID Sbjct: 1 MKKVCWPYFDPDFDKLPERIYGPVCRVSID 30 >ref|XP_008378393.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103441484 [Malus domestica] Length = 503 Score = 63.2 bits (152), Expect = 7e-08 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK+VCWPY+DPDFD+LPERI+GPAC+V ID Sbjct: 1 MKKVCWPYFDPDFDNLPERIYGPACQVCID 30 >ref|XP_006371753.1| hypothetical protein POPTR_0018s01920g [Populus trichocarpa] gi|550317833|gb|ERP49550.1| hypothetical protein POPTR_0018s01920g [Populus trichocarpa] Length = 2224 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 94 SMKRVCWPYYDPDFDSLPERIHGPACRVTID 2 +MK VCWPY+DPDFDSLPERI GP CRV ID Sbjct: 1738 TMKNVCWPYFDPDFDSLPERIFGPTCRVCID 1768 >ref|XP_002324305.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa] gi|550317830|gb|EEF02870.2| hypothetical protein POPTR_0018s01920g [Populus trichocarpa] Length = 2245 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 94 SMKRVCWPYYDPDFDSLPERIHGPACRVTID 2 +MK VCWPY+DPDFDSLPERI GP CRV ID Sbjct: 1759 TMKNVCWPYFDPDFDSLPERIFGPTCRVCID 1789 >gb|ABG37643.1| unknown [Populus trichocarpa] Length = 2224 Score = 62.8 bits (151), Expect = 9e-08 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 94 SMKRVCWPYYDPDFDSLPERIHGPACRVTID 2 +MK VCWPY+DPDFDSLPERI GP CRV ID Sbjct: 1738 TMKNVCWPYFDPDFDSLPERIFGPTCRVCID 1768 >ref|XP_011036590.1| PREDICTED: uncharacterized protein LOC105134046 [Populus euphratica] Length = 485 Score = 62.4 bits (150), Expect = 1e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK VCWPY+DPDFDSLPERI GP CRV ID Sbjct: 1 MKNVCWPYFDPDFDSLPERIFGPTCRVCID 30 >ref|XP_008466435.1| PREDICTED: uncharacterized protein LOC103503843 [Cucumis melo] Length = 469 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK VCWPY+DPDFD+LPERI+GP CRV ID Sbjct: 1 MKNVCWPYFDPDFDTLPERINGPTCRVCID 30 >ref|XP_004136481.1| PREDICTED: ACT domain-containing protein ACR2 [Cucumis sativus] gi|700204949|gb|KGN60082.1| hypothetical protein Csa_3G876050 [Cucumis sativus] Length = 469 Score = 62.0 bits (149), Expect = 1e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK VCWPY+DPDFD+LPERI+GP CRV ID Sbjct: 1 MKNVCWPYFDPDFDTLPERINGPTCRVCID 30 >ref|XP_008219523.1| PREDICTED: uncharacterized protein LOC103319717 isoform X2 [Prunus mume] Length = 491 Score = 61.2 bits (147), Expect = 3e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK++CWPY+DP+FD+LPERI+GP CRV ID Sbjct: 1 MKKICWPYFDPEFDNLPERIYGPTCRVCID 30 >ref|XP_008219522.1| PREDICTED: uncharacterized protein LOC103319717 isoform X1 [Prunus mume] Length = 498 Score = 61.2 bits (147), Expect = 3e-07 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK++CWPY+DP+FD+LPERI+GP CRV ID Sbjct: 1 MKKICWPYFDPEFDNLPERIYGPTCRVCID 30 >ref|XP_012076518.1| PREDICTED: ACT domain-containing protein ACR2 [Jatropha curcas] gi|643724370|gb|KDP33571.1| hypothetical protein JCGZ_07142 [Jatropha curcas] Length = 475 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M +VCWPY+DPDFD+LPERI+GP CRV ID Sbjct: 9 MNKVCWPYFDPDFDNLPERIYGPTCRVCID 38 >ref|XP_002515490.1| amino acid binding protein, putative [Ricinus communis] gi|223545434|gb|EEF46939.1| amino acid binding protein, putative [Ricinus communis] Length = 478 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M++VCWPY+DPDFD LPERI+GP CRV ID Sbjct: 1 MQKVCWPYFDPDFDRLPERIYGPTCRVCID 30 >ref|XP_011081540.1| PREDICTED: uncharacterized protein LOC105164564 [Sesamum indicum] Length = 484 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 100 IRSMKRVCWPYYDPDFDSLPERIHGPACRVTID 2 I M +VC PY+DPDFDSLPERI+GPACRV ID Sbjct: 13 ISRMNKVCSPYFDPDFDSLPERIYGPACRVNID 45 >ref|XP_006450386.1| hypothetical protein CICLE_v10010775mg [Citrus clementina] gi|568859744|ref|XP_006483395.1| PREDICTED: uncharacterized protein LOC102630166 [Citrus sinensis] gi|557553612|gb|ESR63626.1| hypothetical protein CICLE_v10010775mg [Citrus clementina] gi|641842886|gb|KDO61789.1| hypothetical protein CISIN_1g048063mg [Citrus sinensis] Length = 484 Score = 59.7 bits (143), Expect = 7e-07 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M +VCWPY+DP+FD+LPERI+GP CRV ID Sbjct: 1 MNKVCWPYFDPEFDTLPERIYGPTCRVCID 30 >ref|XP_011039651.1| PREDICTED: uncharacterized protein LOC105136133 [Populus euphratica] gi|743892428|ref|XP_011039652.1| PREDICTED: uncharacterized protein LOC105136133 [Populus euphratica] Length = 475 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK VCWPY+DPDFD+L ERI+GP CRV ID Sbjct: 1 MKNVCWPYFDPDFDNLSERIYGPTCRVCID 30 >ref|XP_006382080.1| hypothetical protein POPTR_0006s27260g [Populus trichocarpa] gi|550337184|gb|ERP59877.1| hypothetical protein POPTR_0006s27260g [Populus trichocarpa] Length = 458 Score = 59.3 bits (142), Expect = 1e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK VCWPY+DPDFD+L ERI+GP CRV ID Sbjct: 1 MKNVCWPYFDPDFDNLSERIYGPTCRVCID 30 >ref|XP_007011818.1| ACT-like superfamily protein [Theobroma cacao] gi|508782181|gb|EOY29437.1| ACT-like superfamily protein [Theobroma cacao] Length = 486 Score = 58.9 bits (141), Expect = 1e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M +VCWPY+DP+FD+LPERI+GP CRV ID Sbjct: 1 MMKVCWPYFDPEFDNLPERIYGPPCRVCID 30 >ref|XP_010241627.1| PREDICTED: uncharacterized protein LOC104586168 [Nelumbo nucifera] Length = 496 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/30 (70%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 MK+VCWPY+DP+F++ ERIHGP+CRV ID Sbjct: 1 MKKVCWPYFDPEFENFTERIHGPSCRVCID 30 >ref|XP_010493784.1| PREDICTED: uncharacterized protein LOC104771009 [Camelina sativa] Length = 508 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M++VCWPY+DPDFD+L ERI+GP CRV ID Sbjct: 1 MQKVCWPYFDPDFDNLGERIYGPPCRVYID 30 >ref|XP_010454854.1| PREDICTED: uncharacterized protein LOC104736552 [Camelina sativa] Length = 504 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -2 Query: 91 MKRVCWPYYDPDFDSLPERIHGPACRVTID 2 M++VCWPY+DPDFD+L ERI+GP CRV ID Sbjct: 1 MQKVCWPYFDPDFDNLGERIYGPPCRVYID 30