BLASTX nr result
ID: Forsythia21_contig00038538
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038538 (372 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854190.1| PREDICTED: diphthamide biosynthesis protein ... 82 2e-13 ref|XP_011082319.1| PREDICTED: diphthamide biosynthesis protein ... 79 2e-12 ref|XP_006365966.1| PREDICTED: diphthamide biosynthesis protein ... 74 4e-11 ref|XP_004241760.1| PREDICTED: diphthamide biosynthesis protein ... 74 4e-11 emb|CDP11710.1| unnamed protein product [Coffea canephora] 70 7e-10 ref|XP_010102165.1| Diphthamide biosynthesis protein 1 [Morus no... 65 2e-08 ref|XP_011010116.1| PREDICTED: diphthamide biosynthesis protein ... 64 5e-08 ref|XP_009759721.1| PREDICTED: diphthamide biosynthesis protein ... 64 5e-08 ref|XP_009611471.1| PREDICTED: diphthamide biosynthesis protein ... 64 5e-08 ref|XP_002325444.1| diphthamide synthesis DPH2 family protein [P... 62 1e-07 gb|AES93831.2| diphthamide biosynthesis protein [Medicago trunca... 62 1e-07 ref|XP_004511457.1| PREDICTED: diphthamide biosynthesis protein ... 62 1e-07 ref|XP_003610873.1| Diphthamide biosynthesis protein [Medicago t... 62 1e-07 ref|XP_007041598.1| Diphthamide synthesis DPH2 family protein [T... 61 3e-07 gb|EPS72161.1| hypothetical protein M569_02597 [Genlisea aurea] 60 4e-07 ref|XP_010266635.1| PREDICTED: diphthamide biosynthesis protein ... 60 6e-07 ref|XP_009151323.1| PREDICTED: diphthamide biosynthesis protein ... 60 7e-07 emb|CDX86937.1| BnaC03g52070D [Brassica napus] 60 7e-07 emb|CDY00247.1| BnaA06g21480D [Brassica napus] 60 7e-07 ref|XP_002265458.1| PREDICTED: diphthamide biosynthesis protein ... 60 7e-07 >ref|XP_012854190.1| PREDICTED: diphthamide biosynthesis protein 1 [Erythranthe guttatus] gi|604303962|gb|EYU23312.1| hypothetical protein MIMGU_mgv1a026412mg [Erythranthe guttata] Length = 459 Score = 81.6 bits (200), Expect = 2e-13 Identities = 37/59 (62%), Positives = 42/59 (71%) Frame = +3 Query: 3 TRSEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCNDGCGK 179 TR+E+CC R GVDYPMDYYAQDGG WNS Y+KKP R RKN+QCCN+ C K Sbjct: 402 TRNEECCGNGNGDVR--EGVDYPMDYYAQDGGGWNSCYSKKPARVSRKNNQCCNNSCEK 458 >ref|XP_011082319.1| PREDICTED: diphthamide biosynthesis protein 1 [Sesamum indicum] gi|747070945|ref|XP_011082320.1| PREDICTED: diphthamide biosynthesis protein 1 [Sesamum indicum] Length = 452 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/60 (61%), Positives = 43/60 (71%) Frame = +3 Query: 3 TRSEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCNDGCGKS 182 TRS DCC+ + VQER VDYPMDYYAQDGGEWNS Y KK R KN+Q C++ GK+ Sbjct: 397 TRSGDCCRNENVQER----VDYPMDYYAQDGGEWNSCYLKKSARVRGKNNQVCSNSSGKT 452 >ref|XP_006365966.1| PREDICTED: diphthamide biosynthesis protein 1-like [Solanum tuberosum] Length = 481 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +3 Query: 3 TRSEDC--CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCN 164 +++E C C DG + + E+ VDYPMDYYAQDGGEWNS Y+KKP R +NSQ CN Sbjct: 417 SKNESCGACDNDGEKVKEESQVDYPMDYYAQDGGEWNSCYSKKPARLSHRNSQSCN 472 >ref|XP_004241760.1| PREDICTED: diphthamide biosynthesis protein 1 [Solanum lycopersicum] gi|723709409|ref|XP_010322707.1| PREDICTED: diphthamide biosynthesis protein 1 [Solanum lycopersicum] gi|723709412|ref|XP_010322708.1| PREDICTED: diphthamide biosynthesis protein 1 [Solanum lycopersicum] Length = 483 Score = 73.9 bits (180), Expect = 4e-11 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 2/56 (3%) Frame = +3 Query: 3 TRSEDC--CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCN 164 +++E C C G + + ET VDYPMDYYAQDGGEWNS Y+KKP R ++NSQ CN Sbjct: 419 SKNESCGACDKSGEEVKEETQVDYPMDYYAQDGGEWNSCYSKKPARLSQRNSQSCN 474 >emb|CDP11710.1| unnamed protein product [Coffea canephora] Length = 472 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/53 (58%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = +3 Query: 3 TRSEDCCKYDGV--QERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQ 155 + ++ CC + +E+ E VDYPMDYYAQDGGEWNS YTKKP R++RKN Q Sbjct: 412 SENKSCCASNNGDRKEKNEVVVDYPMDYYAQDGGEWNSCYTKKPTRNLRKNLQ 464 >ref|XP_010102165.1| Diphthamide biosynthesis protein 1 [Morus notabilis] gi|703133684|ref|XP_010105452.1| Diphthamide biosynthesis protein 1 [Morus notabilis] gi|587904214|gb|EXB92415.1| Diphthamide biosynthesis protein 1 [Morus notabilis] gi|587965725|gb|EXC50896.1| Diphthamide biosynthesis protein 1 [Morus notabilis] Length = 464 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/55 (52%), Positives = 35/55 (63%), Gaps = 8/55 (14%) Frame = +3 Query: 6 RSEDCCKY--------DGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRK 146 + DCC +G+ E G +YPMDYYAQDGGEWNSSY KKP+R VR+ Sbjct: 408 KDSDCCNRKCSSCGCGNGMSESERVGGEYPMDYYAQDGGEWNSSYVKKPSRPVRR 462 >ref|XP_011010116.1| PREDICTED: diphthamide biosynthesis protein 1 [Populus euphratica] gi|743931672|ref|XP_011010117.1| PREDICTED: diphthamide biosynthesis protein 1 [Populus euphratica] Length = 460 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/47 (59%), Positives = 33/47 (70%), Gaps = 3/47 (6%) Frame = +3 Query: 18 CCKYDGVQERG---ETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 CC+ +G + G +YPMDYYAQDGGEWNSSY KKP R VR+N Sbjct: 403 CCECSNGDAKGVEKDFGGEYPMDYYAQDGGEWNSSYVKKPTRPVRRN 449 >ref|XP_009759721.1| PREDICTED: diphthamide biosynthesis protein 1 [Nicotiana sylvestris] Length = 480 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +3 Query: 9 SEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCN 164 S C G + + VDYPMDYYAQDGGEWNS Y+KKP R ++ SQ CN Sbjct: 419 SSGACDNGGEKVKEGVLVDYPMDYYAQDGGEWNSCYSKKPARLSQRISQSCN 470 >ref|XP_009611471.1| PREDICTED: diphthamide biosynthesis protein 1 [Nicotiana tomentosiformis] Length = 480 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/52 (53%), Positives = 34/52 (65%) Frame = +3 Query: 9 SEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQCCN 164 S C G + + VDYPMDYYAQDGGEWNS Y+KKP R ++ +Q CN Sbjct: 419 SSGACDNGGEKVKEGVHVDYPMDYYAQDGGEWNSCYSKKPARLSQRINQACN 470 >ref|XP_002325444.1| diphthamide synthesis DPH2 family protein [Populus trichocarpa] gi|222862319|gb|EEE99825.1| diphthamide synthesis DPH2 family protein [Populus trichocarpa] Length = 428 Score = 62.4 bits (150), Expect = 1e-07 Identities = 27/43 (62%), Positives = 30/43 (69%) Frame = +3 Query: 21 CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 C D + G +YPMDYYAQDGGEWNSSY KKP R VR+N Sbjct: 375 CNGDAKGVEKDFGGEYPMDYYAQDGGEWNSSYVKKPTRPVRRN 417 >gb|AES93831.2| diphthamide biosynthesis protein [Medicago truncatula] Length = 463 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +3 Query: 15 DCCKYDGVQERGET---GVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNS 152 DCC T G DYPMDYYAQDGGEWNSSY KKP+R RK S Sbjct: 404 DCCSNGSCGNAKATEDFGGDYPMDYYAQDGGEWNSSYMKKPSRPARKIS 452 >ref|XP_004511457.1| PREDICTED: diphthamide biosynthesis protein 1 [Cicer arietinum] Length = 465 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +3 Query: 15 DCCKYDGVQERGET---GVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNS 152 DCC + ET G DYPMDYYAQDGGEWNSSY KK R RK S Sbjct: 406 DCCSNGSCGDAKETNDFGGDYPMDYYAQDGGEWNSSYVKKSTRPARKIS 454 >ref|XP_003610873.1| Diphthamide biosynthesis protein [Medicago truncatula] Length = 575 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 3/49 (6%) Frame = +3 Query: 15 DCCKYDGVQERGET---GVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNS 152 DCC T G DYPMDYYAQDGGEWNSSY KKP+R RK S Sbjct: 404 DCCSNGSCGNAKATEDFGGDYPMDYYAQDGGEWNSSYMKKPSRPARKIS 452 >ref|XP_007041598.1| Diphthamide synthesis DPH2 family protein [Theobroma cacao] gi|508705533|gb|EOX97429.1| Diphthamide synthesis DPH2 family protein [Theobroma cacao] Length = 458 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/47 (61%), Positives = 33/47 (70%) Frame = +3 Query: 9 SEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 S+ CC G + R + DYPMDYYAQDGGEWNSSY KK R VR+N Sbjct: 404 SKSCC---GCRGREDFRGDYPMDYYAQDGGEWNSSYVKKLARPVRRN 447 >gb|EPS72161.1| hypothetical protein M569_02597 [Genlisea aurea] Length = 440 Score = 60.5 bits (145), Expect = 4e-07 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 2/50 (4%) Frame = +3 Query: 30 DGVQERGETG-VDYPMDYYAQDGGEWNSSYTKKPN-RSVRKNSQCCNDGC 173 +G + R E VDYPMDYY+QDGGEWNSSY KK + R+ K QCC C Sbjct: 388 NGCRNRNEEECVDYPMDYYSQDGGEWNSSYLKKKSGRASGKIGQCCTSSC 437 >ref|XP_010266635.1| PREDICTED: diphthamide biosynthesis protein 1 [Nelumbo nucifera] Length = 464 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/48 (54%), Positives = 32/48 (66%), Gaps = 2/48 (4%) Frame = +3 Query: 18 CCKYDGVQER--GETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKNSQ 155 CCKY+ + ++ DYPMDYYAQDGGEWN SY+KK R+N Q Sbjct: 396 CCKYNNQDSKISEDSAADYPMDYYAQDGGEWNCSYSKKLPHPTRRNLQ 443 >ref|XP_009151323.1| PREDICTED: diphthamide biosynthesis protein 1 [Brassica rapa] gi|685323161|ref|XP_009151324.1| PREDICTED: diphthamide biosynthesis protein 1 [Brassica rapa] gi|685323164|ref|XP_009151325.1| PREDICTED: diphthamide biosynthesis protein 1 [Brassica rapa] Length = 450 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 21 CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 C+ D + G DYPMDYYAQ+GGEWNSSY KK +R +R+N Sbjct: 400 CRDDKKDDDGVLDGDYPMDYYAQEGGEWNSSYLKKSSRPIRRN 442 >emb|CDX86937.1| BnaC03g52070D [Brassica napus] Length = 451 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 21 CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 C+ D + G DYPMDYYAQ+GGEWNSSY KK +R +R+N Sbjct: 401 CRDDKKDDDGVLDGDYPMDYYAQEGGEWNSSYLKKSSRPIRRN 443 >emb|CDY00247.1| BnaA06g21480D [Brassica napus] Length = 450 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/43 (58%), Positives = 31/43 (72%) Frame = +3 Query: 21 CKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN 149 C+ D + G DYPMDYYAQ+GGEWNSSY KK +R +R+N Sbjct: 400 CRDDTKDDDGVLDGDYPMDYYAQEGGEWNSSYLKKSSRPIRRN 442 >ref|XP_002265458.1| PREDICTED: diphthamide biosynthesis protein 1 [Vitis vinifera] gi|731439147|ref|XP_010646701.1| PREDICTED: diphthamide biosynthesis protein 1 [Vitis vinifera] gi|731439149|ref|XP_010646702.1| PREDICTED: diphthamide biosynthesis protein 1 [Vitis vinifera] Length = 461 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 1/55 (1%) Frame = +3 Query: 9 SEDCCKYDGVQERGETGVDYPMDYYAQDGGEWNSSYTKKPNRSVRKN-SQCCNDG 170 +++C +++ + DYPMDYYAQDGGEWNSSY KK R R+N S C +G Sbjct: 404 NDNCDNGVCAKDKVDVSQDYPMDYYAQDGGEWNSSYAKKSTRPSRRNVSSCTGNG 458