BLASTX nr result
ID: Forsythia21_contig00038525
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038525 (434 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006437746.1| hypothetical protein CICLE_v10033717mg [Citr... 56 8e-06 >ref|XP_006437746.1| hypothetical protein CICLE_v10033717mg [Citrus clementina] gi|568861827|ref|XP_006484401.1| PREDICTED: CLAVATA3/ESR (CLE)-related protein 12-like [Citrus sinensis] gi|557539942|gb|ESR50986.1| hypothetical protein CICLE_v10033717mg [Citrus clementina] Length = 124 Score = 56.2 bits (134), Expect = 8e-06 Identities = 33/75 (44%), Positives = 43/75 (57%), Gaps = 9/75 (12%) Frame = -2 Query: 226 MASRISHVFYSILWIFLLLVLFHEFYGLKYLKNYEINGSSST---------LVQHPLIHR 74 MA R SH+ + LW+ LLL LFHE Y K N S +T L ++PLI+R Sbjct: 1 MALRFSHLIFITLWLSLLLFLFHELYNFKSKINTNTKQSITTTTSNTIHYSLSKYPLINR 60 Query: 73 KAMATTKFDFSPFLK 29 K +A +KFDF+PF K Sbjct: 61 KVLA-SKFDFTPFQK 74