BLASTX nr result
ID: Forsythia21_contig00038522
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00038522 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX99916.1| hypothetical protein TI39_contig348g00017 [Zymose... 68 3e-09 ref|XP_007931482.1| hypothetical protein MYCFIDRAFT_212535 [Pseu... 67 4e-09 gb|EME39891.1| hypothetical protein DOTSEDRAFT_74693 [Dothistrom... 65 2e-08 dbj|GAM83189.1| hypothetical protein ANO11243_011750 [fungal sp.... 64 3e-08 ref|XP_007672517.1| hypothetical protein BAUCODRAFT_45916, parti... 60 6e-07 gb|EMF08831.1| hypothetical protein SEPMUDRAFT_151748 [Sphaeruli... 59 2e-06 ref|XP_008076830.1| Chaperone J-domain-containing protein [Glare... 58 2e-06 ref|XP_008723684.1| hypothetical protein G647_02063 [Cladophialo... 56 8e-06 >gb|KJX99916.1| hypothetical protein TI39_contig348g00017 [Zymoseptoria brevis] Length = 338 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/63 (49%), Positives = 39/63 (61%), Gaps = 3/63 (4%) Frame = -1 Query: 180 CNHKGYATLSGTGREHAY---EKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQLV 10 C GYAT++ E K+H WP PP G+ PTPYQIFAL YSKA++Y+LV Sbjct: 43 CRRNGYATVASDAAEQPSPPKSKEHIWPTPPNGRTHPTPYQIFALPVTAPYSKAKYYELV 102 Query: 9 KLY 1 K+Y Sbjct: 103 KIY 105 >ref|XP_007931482.1| hypothetical protein MYCFIDRAFT_212535 [Pseudocercospora fijiensis CIRAD86] gi|452977929|gb|EME77693.1| hypothetical protein MYCFIDRAFT_212535 [Pseudocercospora fijiensis CIRAD86] Length = 328 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/70 (48%), Positives = 40/70 (57%), Gaps = 9/70 (12%) Frame = -1 Query: 183 QCNHKGYATLSGTGREHAY---------EKDHDWPLPPKGQRCPTPYQIFALKKDQAYSK 31 QC GYAT++G + + E H WP P KGQ PTPYQIF LK D Y K Sbjct: 44 QCFQYGYATIAGDSSDKGHSDPAEKAEPEPAHVWPEPHKGQNSPTPYQIFDLKHDGEYRK 103 Query: 30 ARFYQLVKLY 1 A +Y+LVKLY Sbjct: 104 AHYYKLVKLY 113 >gb|EME39891.1| hypothetical protein DOTSEDRAFT_74693 [Dothistroma septosporum NZE10] Length = 331 Score = 64.7 bits (156), Expect = 2e-08 Identities = 33/64 (51%), Positives = 38/64 (59%), Gaps = 5/64 (7%) Frame = -1 Query: 177 NHKGYATLSGTGR-----EHAYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQL 13 + GYAT++G R E H WP PPKG PTPYQIF LK+ AYSK F +L Sbjct: 50 HRSGYATIAGDARVSPEQPERSELSHVWPTPPKGLSQPTPYQIFDLKQSAAYSKGTFNRL 109 Query: 12 VKLY 1 VKLY Sbjct: 110 VKLY 113 >dbj|GAM83189.1| hypothetical protein ANO11243_011750 [fungal sp. No.11243] Length = 336 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/68 (51%), Positives = 40/68 (58%), Gaps = 3/68 (4%) Frame = -1 Query: 195 RHHLQCNHKGYATL---SGTGREHAYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKAR 25 R H Q K YAT+ SG E D WP P+G CPTPYQIFA+ K YSK R Sbjct: 43 RRHGQ-ERKHYATVANDSGHDGEQLDPGDLHWPDAPRGHSCPTPYQIFAIAKTAPYSKTR 101 Query: 24 FYQLVKLY 1 FY+LVK+Y Sbjct: 102 FYELVKIY 109 >ref|XP_007672517.1| hypothetical protein BAUCODRAFT_45916, partial [Baudoinia compniacensis UAMH 10762] gi|449304009|gb|EMD00017.1| hypothetical protein BAUCODRAFT_45916, partial [Baudoinia compniacensis UAMH 10762] Length = 312 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/62 (46%), Positives = 40/62 (64%), Gaps = 7/62 (11%) Frame = -1 Query: 165 YATLSGT-GREH------AYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQLVK 7 YAT++G G +H + + WP P GQ+ PTPYQIFA++ YSKARFY++VK Sbjct: 29 YATIAGDHGSDHHDQHPPSQHSEQAWPTPLNGQQHPTPYQIFAMRSTGEYSKARFYEMVK 88 Query: 6 LY 1 +Y Sbjct: 89 VY 90 >gb|EMF08831.1| hypothetical protein SEPMUDRAFT_151748 [Sphaerulina musiva SO2202] Length = 335 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 9/65 (13%) Frame = -1 Query: 168 GYATLSGT---------GREHAYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQ 16 GYAT++G GR+ AY WP PKG PTPYQIF ++ D YSKA +Y+ Sbjct: 49 GYATMAGDVGGVGEQSDGRDTAYT----WPETPKGHAHPTPYQIFNMRHDGQYSKAGYYK 104 Query: 15 LVKLY 1 LVK+Y Sbjct: 105 LVKMY 109 >ref|XP_008076830.1| Chaperone J-domain-containing protein [Glarea lozoyensis ATCC 20868] gi|512207194|gb|EPE36012.1| Chaperone J-domain-containing protein [Glarea lozoyensis ATCC 20868] Length = 303 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/58 (50%), Positives = 33/58 (56%) Frame = -1 Query: 174 HKGYATLSGTGREHAYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQLVKLY 1 H+GYA +S H + H WP PTPYQIF KK YSK RFY+LVKLY Sbjct: 38 HRGYAMVSDGYSSHNHGT-HRWPEVASANAIPTPYQIFGQKKGSPYSKQRFYELVKLY 94 >ref|XP_008723684.1| hypothetical protein G647_02063 [Cladophialophora carrionii CBS 160.54] gi|565940504|gb|ETI29610.1| hypothetical protein G647_02063 [Cladophialophora carrionii CBS 160.54] Length = 308 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/49 (46%), Positives = 33/49 (67%) Frame = -1 Query: 147 TGREHAYEKDHDWPLPPKGQRCPTPYQIFALKKDQAYSKARFYQLVKLY 1 + REH + + +WP G P+PY+IFAL+K Y+K +FYQLVK+Y Sbjct: 44 SSREHDFPDNMNWPCRRNGSSSPSPYEIFALEKHAVYTKHKFYQLVKIY 92