BLASTX nr result
ID: Forsythia21_contig00037949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037949 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO63251.1| hypothetical protein CISIN_1g023956mg [Citrus sin... 56 8e-06 >gb|KDO63251.1| hypothetical protein CISIN_1g023956mg [Citrus sinensis] Length = 212 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 2/48 (4%) Frame = -1 Query: 188 NIRGGRVKLHTITNPPIEFYNVEKGDALYGKYSFIPQ--HHVWYTLER 51 N+RGG+VKLH+I PP EF + EKGDALYGK+S + +H+ Y++ R Sbjct: 153 NLRGGKVKLHSIMQPPSEFDHAEKGDALYGKFSGLTAALNHLIYSISR 200