BLASTX nr result
ID: Forsythia21_contig00037926
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037926 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090466.1| PREDICTED: bifunctional aspartate aminotrans... 63 9e-08 >ref|XP_011090466.1| PREDICTED: bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase [Sesamum indicum] Length = 481 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/75 (45%), Positives = 44/75 (58%) Frame = +2 Query: 56 AAYSLQASSGIASTHIQLKPHADXXXXXXXXXXXXXXXXXXXXXQTTRKINLQRISAAVK 235 A+YS+QA+S +AS IQLKP +D TTR+++LQR+SA V+ Sbjct: 5 ASYSIQATSSVASARIQLKPQSDSLSSSSLSFSSQLQPCSIKSLHTTRQLHLQRVSAVVR 64 Query: 236 TESRSDTMEVDISLS 280 E S TMEVDISLS Sbjct: 65 AEINSHTMEVDISLS 79