BLASTX nr result
ID: Forsythia21_contig00037546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037546 (270 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011102235.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 ref|XP_011102176.1| PREDICTED: pentatricopeptide repeat-containi... 65 1e-08 gb|EPS57640.1| hypothetical protein M569_17176, partial [Genlise... 58 2e-06 >ref|XP_011102235.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like [Sesamum indicum] Length = 817 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/73 (46%), Positives = 40/73 (54%) Frame = -1 Query: 219 HRKFNDARRILQTHIVSDXXXXXXXXXXXXXXXXXXXXXXXXLDTSISAYCHSGWPHLAA 40 H KF+DA+ ILQ+ I ++ L+T I AYC SGWPHLAA Sbjct: 134 HHKFDDAKSILQSQITAEHPHHQLHRHLLHPAPPLPPPSKALLNTCIFAYCRSGWPHLAA 193 Query: 39 QIFKKMKRHGRRP 1 QIFKKMKRH RP Sbjct: 194 QIFKKMKRHKLRP 206 >ref|XP_011102176.1| PREDICTED: pentatricopeptide repeat-containing protein At2g16880-like, partial [Sesamum indicum] Length = 772 Score = 65.5 bits (158), Expect = 1e-08 Identities = 34/73 (46%), Positives = 40/73 (54%) Frame = -1 Query: 219 HRKFNDARRILQTHIVSDXXXXXXXXXXXXXXXXXXXXXXXXLDTSISAYCHSGWPHLAA 40 H KF+DA+ ILQ+ I ++ L+T I AYC SGWPHLAA Sbjct: 89 HHKFDDAKSILQSQITAEHPHHQLHRHLLHPAPPLPPPSKALLNTCIFAYCRSGWPHLAA 148 Query: 39 QIFKKMKRHGRRP 1 QIFKKMKRH RP Sbjct: 149 QIFKKMKRHKLRP 161 >gb|EPS57640.1| hypothetical protein M569_17176, partial [Genlisea aurea] Length = 731 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/73 (39%), Positives = 37/73 (50%) Frame = -1 Query: 219 HRKFNDARRILQTHIVSDXXXXXXXXXXXXXXXXXXXXXXXXLDTSISAYCHSGWPHLAA 40 H KF DA+R++ + I+S+ LD IS+YC SGWP A Sbjct: 85 HHKFVDAQRVIDSQIISEHPHHHLHRHLLRPAPPLPPPSKLLLDICISSYCRSGWPQFGA 144 Query: 39 QIFKKMKRHGRRP 1 QIFKKMKRH +P Sbjct: 145 QIFKKMKRHKLQP 157