BLASTX nr result
ID: Forsythia21_contig00037502
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00037502 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177... 75 2e-11 emb|CDP05915.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_002519065.1| conserved hypothetical protein [Ricinus comm... 60 4e-07 ref|XP_012848479.1| PREDICTED: uncharacterized protein LOC105968... 57 6e-06 >ref|XP_011098409.1| PREDICTED: uncharacterized protein LOC105177084 [Sesamum indicum] Length = 931 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/64 (59%), Positives = 44/64 (68%) Frame = -1 Query: 196 EEGKFRNLDGVLKLKFASEKPNIFTSLVSGTLESINLPKNLGYFEPISIFDFPYLSEYTY 17 EEGK NLD VLKL FASE P+I+TS+ SG LES + GYF+PI +F FP Y Y Sbjct: 167 EEGKNVNLDAVLKLHFASENPDIYTSVASGILESAGSANDPGYFDPILMFSFPDFPNYNY 226 Query: 16 SLVS 5 SLVS Sbjct: 227 SLVS 230 >emb|CDP05915.1| unnamed protein product [Coffea canephora] Length = 932 Score = 61.2 bits (147), Expect = 3e-07 Identities = 30/66 (45%), Positives = 39/66 (59%) Frame = -1 Query: 202 QSEEGKFRNLDGVLKLKFASEKPNIFTSLVSGTLESINLPKNLGYFEPISIFDFPYLSEY 23 QS EGK RNL+ V + A + TSL GTL+S++ + YFEPI I P LS+Y Sbjct: 169 QSAEGKPRNLEAVFQFNHAKNNSTLLTSLARGTLKSLSSSNSPNYFEPIEIVSLPVLSDY 228 Query: 22 TYSLVS 5 Y+L S Sbjct: 229 NYTLAS 234 >ref|XP_002519065.1| conserved hypothetical protein [Ricinus communis] gi|223541728|gb|EEF43276.1| conserved hypothetical protein [Ricinus communis] Length = 964 Score = 60.5 bits (145), Expect = 4e-07 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = -1 Query: 184 FRNLDGVLKLKFASEKPNIFTSLVSGTLESINLPKNLGYFEPISIFDFPYLSEYTYSLVS 5 F N + VLKLK+ N+ +SL+SG LES+N +LGYFEPISI P+ EY Y+L++ Sbjct: 208 FNNTNVVLKLKYPVVFSNV-SSLISGVLESVNDKSSLGYFEPISILGIPHFGEYNYTLIN 266 >ref|XP_012848479.1| PREDICTED: uncharacterized protein LOC105968395 [Erythranthe guttatus] gi|604346497|gb|EYU44941.1| hypothetical protein MIMGU_mgv1a019300mg [Erythranthe guttata] Length = 854 Score = 56.6 bits (135), Expect = 6e-06 Identities = 34/66 (51%), Positives = 41/66 (62%), Gaps = 1/66 (1%) Frame = -1 Query: 199 SEEGKFRNLDGVLKLKFASEK-PNIFTSLVSGTLESINLPKNLGYFEPISIFDFPYLSEY 23 SEEG+ NLD L LKFA K P I +S VSG L+S + + F+P+ IF FP L Y Sbjct: 156 SEEGQTVNLDAALNLKFADRKNPTILSSFVSGILKS--MANSSANFDPLLIFGFPVLPLY 213 Query: 22 TYSLVS 5 YSLVS Sbjct: 214 GYSLVS 219