BLASTX nr result
ID: Forsythia21_contig00036390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00036390 (256 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001132898.1| uncharacterized protein LOC100194395 [Zea ma... 61 1e-16 ref|XP_008654450.1| PREDICTED: uncharacterized protein LOC100194... 61 1e-16 dbj|BAK04354.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-16 ref|XP_003565020.1| PREDICTED: mitochondrial thiamine pyrophosph... 57 1e-16 ref|XP_010232786.1| PREDICTED: mitochondrial thiamine pyrophosph... 57 1e-16 ref|XP_009419905.1| PREDICTED: mitochondrial thiamine pyrophosph... 55 4e-15 ref|XP_010524706.1| PREDICTED: mitochondrial thiamine pyrophosph... 58 8e-14 gb|EMS58617.1| Mitochondrial thiamine pyrophosphate carrier 1 [T... 55 1e-13 gb|EMT00582.1| Mitochondrial thiamine pyrophosphate carrier 1 [A... 55 1e-13 ref|XP_009414130.1| PREDICTED: mitochondrial thiamine pyrophosph... 53 4e-13 ref|XP_009414131.1| PREDICTED: mitochondrial thiamine pyrophosph... 53 4e-13 gb|KCW61125.1| hypothetical protein EUGRSUZ_H03898 [Eucalyptus g... 51 7e-12 ref|XP_010024686.1| PREDICTED: mitochondrial thiamine pyrophosph... 51 7e-12 ref|XP_010548933.1| PREDICTED: mitochondrial thiamine pyrophosph... 49 7e-11 ref|XP_010024683.1| PREDICTED: mitochondrial thiamine pyrophosph... 48 9e-11 ref|XP_010024684.1| PREDICTED: mitochondrial thiamine pyrophosph... 48 9e-11 dbj|BAB03052.1| mitochondrial carrier protein-like [Arabidopsis ... 49 8e-09 ref|NP_566683.1| mitochondrial thiamin diphosphate carrier prote... 49 8e-09 ref|XP_010466378.1| PREDICTED: mitochondrial thiamine pyrophosph... 49 1e-08 ref|XP_011090946.1| PREDICTED: mitochondrial thiamine pyrophosph... 66 1e-08 >ref|NP_001132898.1| uncharacterized protein LOC100194395 [Zea mays] gi|194695698|gb|ACF81933.1| unknown [Zea mays] gi|195626132|gb|ACG34896.1| mitochondrial deoxynucleotide carrier [Zea mays] gi|413951383|gb|AFW84032.1| deoxynucleotide carrier [Zea mays] Length = 336 Score = 61.2 bits (147), Expect(2) = 1e-16 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPTT +LR+D YGPSKY+ +LQAT+D+ REEGLP FW+ Sbjct: 43 VQLEPTTSWGILRRDVYGPSKYTGLLQATKDILREEGLPGFWR 85 Score = 51.6 bits (122), Expect(2) = 1e-16 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+ LSPYL Sbjct: 86 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLDLSPYL 128 >ref|XP_008654450.1| PREDICTED: uncharacterized protein LOC100194395 isoform X1 [Zea mays] gi|413951382|gb|AFW84031.1| hypothetical protein ZEAMMB73_394006 [Zea mays] Length = 333 Score = 61.2 bits (147), Expect(2) = 1e-16 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPTT +LR+D YGPSKY+ +LQAT+D+ REEGLP FW+ Sbjct: 43 VQLEPTTSWGILRRDVYGPSKYTGLLQATKDILREEGLPGFWR 85 Score = 51.6 bits (122), Expect(2) = 1e-16 Identities = 25/43 (58%), Positives = 27/43 (62%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+ LSPYL Sbjct: 86 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLDLSPYL 128 >dbj|BAK04354.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 332 Score = 57.8 bits (138), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT +LR+D YGPSKY+ ++QAT+D+ REEGLP FW+ Sbjct: 45 VQLEPTATWGVLRRDVYGPSKYTGLMQATKDILREEGLPGFWR 87 Score = 55.1 bits (131), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+HLSPYL Sbjct: 88 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLHLSPYL 130 >ref|XP_003565020.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1 [Brachypodium distachyon] Length = 332 Score = 57.4 bits (137), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT LR+D YGPSKY+ ++QAT+D+ REEGLP FW+ Sbjct: 43 VQLEPTASWGALRRDVYGPSKYTGLMQATKDILREEGLPGFWR 85 Score = 55.1 bits (131), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+HLSPYL Sbjct: 86 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLHLSPYL 128 >ref|XP_010232786.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X2 [Brachypodium distachyon] Length = 330 Score = 57.4 bits (137), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT LR+D YGPSKY+ ++QAT+D+ REEGLP FW+ Sbjct: 43 VQLEPTASWGALRRDVYGPSKYTGLMQATKDILREEGLPGFWR 85 Score = 55.1 bits (131), Expect(2) = 1e-16 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+HLSPYL Sbjct: 86 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLHLSPYL 128 >ref|XP_009419905.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 331 Score = 55.1 bits (131), Expect(2) = 4e-15 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V +EPT+ ALL++D YG SKY+ +LQAT D+FREEGL FW+ Sbjct: 40 VQIEPTSSWALLKRDLYGTSKYTGILQATRDIFREEGLSGFWR 82 Score = 52.4 bits (124), Expect(2) = 4e-15 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALL+ MPYT QFTVLH +EDH+ LSPYL Sbjct: 83 GNVPALLLYMPYTAIQFTVLHKLKTFAAGSSKTEDHLQLSPYL 125 >ref|XP_010524706.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Tarenaya hassleriana] Length = 338 Score = 58.2 bits (139), Expect(2) = 8e-14 Identities = 28/43 (65%), Positives = 31/43 (72%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT+ QFTVLH +EDHIHLSPYL Sbjct: 89 GNVPALLMVVPYTSIQFTVLHKLKSIAAGSSKTEDHIHLSPYL 131 Score = 45.1 bits (105), Expect(2) = 8e-14 Identities = 24/43 (55%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPTT AL+R + SKY+ +LQA+ D+FREEGL FW+ Sbjct: 46 VQLEPTTSWALVRGNLSVASKYTGVLQASRDIFREEGLRGFWR 88 >gb|EMS58617.1| Mitochondrial thiamine pyrophosphate carrier 1 [Triticum urartu] Length = 350 Score = 55.1 bits (131), Expect(2) = 1e-13 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+HLSPYL Sbjct: 73 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLHLSPYL 115 Score = 47.4 bits (111), Expect(2) = 1e-13 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGL 144 V LEPT + +LR+D YGPSKY+ ++QAT+D+ REE L Sbjct: 26 VQLEPTAKWGVLRRDVYGPSKYTGLMQATKDILREEAL 63 >gb|EMT00582.1| Mitochondrial thiamine pyrophosphate carrier 1 [Aegilops tauschii] Length = 346 Score = 55.1 bits (131), Expect(2) = 1e-13 Identities = 26/43 (60%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPAL M MPYT QFTVLH +EDH+HLSPYL Sbjct: 90 GNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLHLSPYL 132 Score = 47.4 bits (111), Expect(2) = 1e-13 Identities = 22/38 (57%), Positives = 30/38 (78%), Gaps = 1/38 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGL 144 V LEPT + +LR+D YGPSKY+ ++QAT+D+ REE L Sbjct: 43 VQLEPTAKWGVLRRDVYGPSKYTGLMQATKDILREEAL 80 >ref|XP_009414130.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 331 Score = 53.1 bits (126), Expect(2) = 4e-13 Identities = 27/49 (55%), Positives = 30/49 (61%) Frame = -2 Query: 147 LTEVLAGNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 LT GNVPALL+ MPYT QFTVLH +EDH+ LSPYL Sbjct: 77 LTGFWRGNVPALLLYMPYTAIQFTVLHKLKTIAAGSSKAEDHLKLSPYL 125 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ ALL +D+YG SKY+ +LQ+++ + REEGL FW+ Sbjct: 40 VQLEPTSSWALLHRDSYGSSKYTGILQSSKVILREEGLTGFWR 82 >ref|XP_009414131.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 281 Score = 53.1 bits (126), Expect(2) = 4e-13 Identities = 27/49 (55%), Positives = 30/49 (61%) Frame = -2 Query: 147 LTEVLAGNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 LT GNVPALL+ MPYT QFTVLH +EDH+ LSPYL Sbjct: 77 LTGFWRGNVPALLLYMPYTAIQFTVLHKLKTIAAGSSKAEDHLKLSPYL 125 Score = 47.8 bits (112), Expect(2) = 4e-13 Identities = 23/43 (53%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ ALL +D+YG SKY+ +LQ+++ + REEGL FW+ Sbjct: 40 VQLEPTSSWALLHRDSYGSSKYTGILQSSKVILREEGLTGFWR 82 >gb|KCW61125.1| hypothetical protein EUGRSUZ_H03898 [Eucalyptus grandis] Length = 353 Score = 51.2 bits (121), Expect(2) = 7e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT QFTVL +ED +HLSPYL Sbjct: 105 GNVPALLMVVPYTAIQFTVLQKLKTIAAGSSKAEDQVHLSPYL 147 Score = 45.4 bits (106), Expect(2) = 7e-12 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ AL+ + SKY+ + QAT+D+FREEGLP FW+ Sbjct: 62 VQLEPTSTWALVGSNLPARSKYTGIFQATKDIFREEGLPGFWR 104 >ref|XP_010024686.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Eucalyptus grandis] Length = 331 Score = 51.2 bits (121), Expect(2) = 7e-12 Identities = 25/43 (58%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT QFTVL +ED +HLSPYL Sbjct: 83 GNVPALLMVVPYTAIQFTVLQKLKTIAAGSSKAEDQVHLSPYL 125 Score = 45.4 bits (106), Expect(2) = 7e-12 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ AL+ + SKY+ + QAT+D+FREEGLP FW+ Sbjct: 40 VQLEPTSTWALVGSNLPARSKYTGIFQATKDIFREEGLPGFWR 82 >ref|XP_010548933.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1 [Tarenaya hassleriana] gi|729375348|ref|XP_010548934.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier 1 [Tarenaya hassleriana] Length = 335 Score = 49.3 bits (116), Expect(2) = 7e-11 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT+ QF VLH +E+H LSPYL Sbjct: 88 GNVPALLMVVPYTSIQFVVLHKFKSFAAGSSKTENHARLSPYL 130 Score = 43.9 bits (102), Expect(2) = 7e-11 Identities = 23/43 (53%), Positives = 30/43 (69%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT AL +KD+ KY+ +LQ T+D+FREEGL FW+ Sbjct: 45 VQLEPTASWALTQKDSPVRPKYNGLLQTTKDIFREEGLLGFWR 87 >ref|XP_010024683.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X1 [Eucalyptus grandis] gi|629095132|gb|KCW61127.1| hypothetical protein EUGRSUZ_H03901 [Eucalyptus grandis] Length = 331 Score = 47.8 bits (112), Expect(2) = 9e-11 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLM +P+T QFTVL +ED +HLSPYL Sbjct: 83 GNVPALLMTVPHTAIQFTVLQKLKTIAAGSSKAEDQVHLSPYL 125 Score = 45.1 bits (105), Expect(2) = 9e-11 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ AL+ + SKY+ +LQAT+D+FR+EGLP FW+ Sbjct: 40 VQLEPTSTWALVGSNLPTRSKYTGVLQATKDIFRDEGLPGFWR 82 >ref|XP_010024684.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Eucalyptus grandis] Length = 280 Score = 47.8 bits (112), Expect(2) = 9e-11 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLM +P+T QFTVL +ED +HLSPYL Sbjct: 83 GNVPALLMTVPHTAIQFTVLQKLKTIAAGSSKAEDQVHLSPYL 125 Score = 45.1 bits (105), Expect(2) = 9e-11 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT+ AL+ + SKY+ +LQAT+D+FR+EGLP FW+ Sbjct: 40 VQLEPTSTWALVGSNLPTRSKYTGVLQATKDIFRDEGLPGFWR 82 >dbj|BAB03052.1| mitochondrial carrier protein-like [Arabidopsis thaliana] Length = 346 Score = 49.3 bits (116), Expect(2) = 8e-09 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT+ QF VLH +E+H LSPYL Sbjct: 97 GNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYL 139 Score = 37.0 bits (84), Expect(2) = 8e-09 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT AL KD+ KY+ + + T+D+FREEGL FW+ Sbjct: 56 VQLEPTATWAL--KDSQLKPKYNGLFRTTKDIFREEGLSGFWR 96 >ref|NP_566683.1| mitochondrial thiamin diphosphate carrier protein [Arabidopsis thaliana] gi|19347718|gb|AAL85968.1| unknown protein [Arabidopsis thaliana] gi|21593478|gb|AAM65445.1| mitochondrial carrier protein-like [Arabidopsis thaliana] gi|21689713|gb|AAM67478.1| unknown protein [Arabidopsis thaliana] gi|332642983|gb|AEE76504.1| mitochondrial thiamin diphosphate carrier protein [Arabidopsis thaliana] Length = 335 Score = 49.3 bits (116), Expect(2) = 8e-09 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT+ QF VLH +E+H LSPYL Sbjct: 86 GNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYL 128 Score = 37.0 bits (84), Expect(2) = 8e-09 Identities = 21/43 (48%), Positives = 28/43 (65%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT AL KD+ KY+ + + T+D+FREEGL FW+ Sbjct: 45 VQLEPTATWAL--KDSQLKPKYNGLFRTTKDIFREEGLSGFWR 85 >ref|XP_010466378.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Camelina sativa] gi|727586669|ref|XP_010466379.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Camelina sativa] gi|727586671|ref|XP_010466380.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Camelina sativa] Length = 333 Score = 49.3 bits (116), Expect(2) = 1e-08 Identities = 24/43 (55%), Positives = 28/43 (65%) Frame = -2 Query: 129 GNVPALLMVMPYTTKQFTVLHXXXXXXXXXXXSEDHIHLSPYL 1 GNVPALLMV+PYT+ QF VLH +E+H LSPYL Sbjct: 88 GNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAENHAQLSPYL 130 Score = 36.6 bits (83), Expect(2) = 1e-08 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ 129 V LEPT AL + D+ KY+ + + +++FREEGL FW+ Sbjct: 45 VQLEPTASWALTKNDSPLKPKYNGLFRTAKEIFREEGLSGFWR 87 >ref|XP_011090946.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Sesamum indicum] gi|747086858|ref|XP_011090947.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like isoform X2 [Sesamum indicum] Length = 329 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/55 (61%), Positives = 41/55 (74%), Gaps = 7/55 (12%) Frame = -3 Query: 254 VPLEPTTQLALLRKDAYGPSKYS-MLQATEDMFREEGLPRFWQ------VMSQPY 111 V LEPTTQ ALLR+D Y P+KY+ MLQAT+D+FREEGLP FW+ +M PY Sbjct: 40 VQLEPTTQWALLRRDVYNPAKYTGMLQATKDIFREEGLPGFWRGNVPALLMVMPY 94