BLASTX nr result
ID: Forsythia21_contig00036344
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00036344 (266 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008808560.1| PREDICTED: pentatricopeptide repeat-containi... 58 3e-06 >ref|XP_008808560.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27610 [Phoenix dactylifera] Length = 853 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/52 (42%), Positives = 41/52 (78%) Frame = -3 Query: 261 IELRDEIHNFVANDRSHPKSELIYRLLMKLEVRMREENNVPNMDYFLQDAED 106 I++++++H+F+A+DR+HP SELIY L ++ +R+++E PN+D+ L D E+ Sbjct: 724 IQVKNKVHSFIASDRNHPLSELIYAKLEEMMIRLKKEGYHPNLDFVLHDMEE 775