BLASTX nr result
ID: Forsythia21_contig00036160
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00036160 (246 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99588.1| unnamed protein product [Coffea canephora] 66 1e-08 >emb|CDO99588.1| unnamed protein product [Coffea canephora] Length = 287 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = -2 Query: 152 MGLSTTQVSDDHMIDWSKTLPQSGEVEPPEPPSMRRQKQPQQQLMAPLKC 3 MGL+T QVS DH +DW++TL SG VE P+PP +RQ+Q QQQ PLKC Sbjct: 1 MGLNTKQVSSDHPLDWNQTLLDSGAVELPKPPPAKRQQQNQQQQSEPLKC 50