BLASTX nr result
ID: Forsythia21_contig00036071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00036071 (250 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071821.1| PREDICTED: RNA-dependent RNA polymerase 2 [S... 70 7e-10 emb|CDP19325.1| unnamed protein product [Coffea canephora] 65 2e-08 ref|XP_006345040.1| PREDICTED: RNA-dependent RNA polymerase 2-li... 59 1e-06 ref|XP_009796585.1| PREDICTED: RNA-dependent RNA polymerase 2 [N... 59 1e-06 ref|XP_002321582.1| hypothetical protein POPTR_0015s08500g [Popu... 59 1e-06 gb|AAU21243.1| putative RNA-dependent RNA polymerase RdRP2 [Nico... 59 1e-06 ref|XP_004236120.1| PREDICTED: RNA-dependent RNA polymerase 2 [S... 58 2e-06 ref|XP_009623301.1| PREDICTED: RNA-dependent RNA polymerase 2 [N... 58 3e-06 ref|XP_011028594.1| PREDICTED: RNA-dependent RNA polymerase 2 [P... 57 5e-06 ref|XP_012831187.1| PREDICTED: RNA-dependent RNA polymerase 2 [E... 57 6e-06 >ref|XP_011071821.1| PREDICTED: RNA-dependent RNA polymerase 2 [Sesamum indicum] Length = 1133 Score = 69.7 bits (169), Expect = 7e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKS 147 +VTYHPTYSHGSANCLGFPW VGNILL+IKS K+ Sbjct: 1091 FVTYHPTYSHGSANCLGFPWAVGNILLDIKSAKN 1124 >emb|CDP19325.1| unnamed protein product [Coffea canephora] Length = 1120 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKNV 138 +VTYHPTYS GSA CLGFPWIVG+ILL+IKS S+ V Sbjct: 1082 HVTYHPTYSEGSAKCLGFPWIVGDILLDIKSMNSRKV 1118 >ref|XP_006345040.1| PREDICTED: RNA-dependent RNA polymerase 2-like [Solanum tuberosum] Length = 1119 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKS 156 +VTYHP+Y H SANCLGFPW+VG+ILL IKS Sbjct: 1081 HVTYHPSYCHESANCLGFPWVVGDILLNIKS 1111 >ref|XP_009796585.1| PREDICTED: RNA-dependent RNA polymerase 2 [Nicotiana sylvestris] Length = 1120 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKNV 138 +VTYHP+Y GSANCLGFPW+VG+ILL+IK ++ + Sbjct: 1082 HVTYHPSYCEGSANCLGFPWVVGDILLDIKLHNTRKI 1118 >ref|XP_002321582.1| hypothetical protein POPTR_0015s08500g [Populus trichocarpa] gi|222868578|gb|EEF05709.1| hypothetical protein POPTR_0015s08500g [Populus trichocarpa] Length = 1110 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/36 (69%), Positives = 28/36 (77%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKN 141 +VTYHPTY H NCL FPWIVG+ILL IKS S+N Sbjct: 1074 HVTYHPTYFHERMNCLSFPWIVGDILLNIKSLNSRN 1109 >gb|AAU21243.1| putative RNA-dependent RNA polymerase RdRP2 [Nicotiana benthamiana] Length = 1120 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKNV 138 +VTYHP+Y GSANCLGFPW+VG+ILL+IK ++ + Sbjct: 1082 HVTYHPSYCEGSANCLGFPWVVGDILLDIKLHNTRKI 1118 >ref|XP_004236120.1| PREDICTED: RNA-dependent RNA polymerase 2 [Solanum lycopersicum] Length = 1119 Score = 58.2 bits (139), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKS 156 +VTYHP+Y H SANCLGFPW+VG+ILL +KS Sbjct: 1081 HVTYHPSYCHESANCLGFPWVVGDILLNMKS 1111 >ref|XP_009623301.1| PREDICTED: RNA-dependent RNA polymerase 2 [Nicotiana tomentosiformis] Length = 1120 Score = 57.8 bits (138), Expect = 3e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = -3 Query: 245 VTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKNV 138 VTYHP+Y GSANCLGFPW+VG++LL+IK ++ + Sbjct: 1083 VTYHPSYCQGSANCLGFPWVVGDVLLDIKLHNTRKI 1118 >ref|XP_011028594.1| PREDICTED: RNA-dependent RNA polymerase 2 [Populus euphratica] Length = 1105 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/36 (66%), Positives = 27/36 (75%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSKN 141 +VTYHPTY H NCL FPWIVG+ILL IKS +N Sbjct: 1069 HVTYHPTYFHERMNCLSFPWIVGDILLNIKSLNRRN 1104 >ref|XP_012831187.1| PREDICTED: RNA-dependent RNA polymerase 2 [Erythranthe guttatus] gi|604343689|gb|EYU42543.1| hypothetical protein MIMGU_mgv1a000463mg [Erythranthe guttata] Length = 1135 Score = 56.6 bits (135), Expect = 6e-06 Identities = 22/35 (62%), Positives = 30/35 (85%) Frame = -3 Query: 248 YVTYHPTYSHGSANCLGFPWIVGNILLEIKSCKSK 144 YVTYHP+Y GS +CLGFPW VG++L++IKS K++ Sbjct: 1093 YVTYHPSYVDGSEHCLGFPWAVGDVLMDIKSDKNR 1127