BLASTX nr result
ID: Forsythia21_contig00035718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035718 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009788101.1| PREDICTED: haloacid dehalogenase-like hydrol... 60 6e-07 ref|XP_010316525.1| PREDICTED: haloacid dehalogenase-like hydrol... 57 6e-06 >ref|XP_009788101.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3 isoform X1 [Nicotiana sylvestris] Length = 301 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -3 Query: 152 IYQVFFPCTTIDPGLKDSAVVIFTMSLLTKLRCITIDVTGTLLAYKGELG 3 +++ F T+ GL + AV FTMS+LTKLRCIT+DVTGTL+AYKGELG Sbjct: 23 VHEAFEVQDTVITGL-EFAVQSFTMSMLTKLRCITLDVTGTLIAYKGELG 71 >ref|XP_010316525.1| PREDICTED: haloacid dehalogenase-like hydrolase domain-containing protein 3 isoform X1 [Solanum lycopersicum] Length = 282 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -3 Query: 98 AVVIFTMSLLTKLRCITIDVTGTLLAYKGELG 3 +V FTMS+LTKLRCIT+DVTGTL+AYKGELG Sbjct: 21 SVQSFTMSILTKLRCITLDVTGTLIAYKGELG 52