BLASTX nr result
ID: Forsythia21_contig00035568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035568 (306 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008029844.1| hypothetical protein SETTUDRAFT_156514 [Seto... 84 3e-14 ref|XP_007683230.1| hypothetical protein COCMIDRAFT_82455 [Bipol... 83 6e-14 ref|XP_001798653.1| hypothetical protein SNOG_08333 [Phaeosphaer... 83 8e-14 gb|EUN30862.1| hypothetical protein COCVIDRAFT_23323 [Bipolaris ... 81 2e-13 ref|XP_003843449.1| hypothetical protein LEMA_uP075590.1 [Leptos... 77 4e-12 ref|XP_001938508.1| hypothetical protein PTRG_08176 [Pyrenophora... 75 2e-11 ref|XP_003301156.1| hypothetical protein PTT_12591 [Pyrenophora ... 72 1e-10 >ref|XP_008029844.1| hypothetical protein SETTUDRAFT_156514 [Setosphaeria turcica Et28A] gi|482805761|gb|EOA82847.1| hypothetical protein SETTUDRAFT_156514 [Setosphaeria turcica Et28A] Length = 59 Score = 84.3 bits (207), Expect = 3e-14 Identities = 42/59 (71%), Positives = 45/59 (76%) Frame = -1 Query: 252 MPPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 MPPK M GKGRT+ EP SKENRSIVTAAG+FA+GVTFLHSSWAEILLPA Sbjct: 1 MPPKYMTGKGRTIQEPSFASSVISTFTSKENRSIVTAAGLFALGVTFLHSSWAEILLPA 59 >ref|XP_007683230.1| hypothetical protein COCMIDRAFT_82455 [Bipolaris oryzae ATCC 44560] gi|628082430|ref|XP_007703065.1| hypothetical protein COCSADRAFT_39580 [Bipolaris sorokiniana ND90Pr] gi|628191354|ref|XP_007708701.1| hypothetical protein COCCADRAFT_86583 [Bipolaris zeicola 26-R-13] gi|451847559|gb|EMD60866.1| hypothetical protein COCSADRAFT_39580 [Bipolaris sorokiniana ND90Pr] gi|451996627|gb|EMD89093.1| hypothetical protein COCHEDRAFT_1022610 [Bipolaris maydis C5] gi|477588107|gb|ENI05187.1| hypothetical protein COCC4DRAFT_32238 [Bipolaris maydis ATCC 48331] gi|576922944|gb|EUC37067.1| hypothetical protein COCCADRAFT_86583 [Bipolaris zeicola 26-R-13] gi|576936865|gb|EUC50357.1| hypothetical protein COCMIDRAFT_82455 [Bipolaris oryzae ATCC 44560] Length = 59 Score = 83.2 bits (204), Expect = 6e-14 Identities = 42/59 (71%), Positives = 44/59 (74%) Frame = -1 Query: 252 MPPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 MPPK M GKGRT+ EP SKENRSIVTAAGMFA+GV FLHSSWAEILLPA Sbjct: 1 MPPKYMTGKGRTVQEPSFASSTISAFTSKENRSIVTAAGMFALGVAFLHSSWAEILLPA 59 >ref|XP_001798653.1| hypothetical protein SNOG_08333 [Phaeosphaeria nodorum SN15] gi|160702074|gb|EAT84609.2| hypothetical protein SNOG_08333 [Phaeosphaeria nodorum SN15] Length = 102 Score = 82.8 bits (203), Expect = 8e-14 Identities = 41/59 (69%), Positives = 44/59 (74%) Frame = -1 Query: 252 MPPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 MPPKQ+ GKGRTL EP KENRS+VTA G+FAIGVTFLHSSWAEILLPA Sbjct: 44 MPPKQIHGKGRTLAEPSFAANTLHAFTDKENRSVVTAIGLFAIGVTFLHSSWAEILLPA 102 >gb|EUN30862.1| hypothetical protein COCVIDRAFT_23323 [Bipolaris victoriae FI3] Length = 59 Score = 81.3 bits (199), Expect = 2e-13 Identities = 41/59 (69%), Positives = 43/59 (72%) Frame = -1 Query: 252 MPPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 MPPK M GKGRT+ EP SKENRSIV AAGMFA+GV FLHSSWAEILLPA Sbjct: 1 MPPKYMTGKGRTVQEPSFASSTISAFTSKENRSIVAAAGMFALGVAFLHSSWAEILLPA 59 >ref|XP_003843449.1| hypothetical protein LEMA_uP075590.1 [Leptosphaeria maculans JN3] gi|312220028|emb|CBX99970.1| hypothetical protein LEMA_uP075590.1 [Leptosphaeria maculans JN3] Length = 59 Score = 77.0 bits (188), Expect = 4e-12 Identities = 39/59 (66%), Positives = 42/59 (71%) Frame = -1 Query: 252 MPPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 MPPK + GKGRTL EP S ENRS+V A G+FAIGVTFLHSSWAEILLPA Sbjct: 1 MPPKHIQGKGRTLKEPNFAQSTLRALTSAENRSVVGAIGLFAIGVTFLHSSWAEILLPA 59 >ref|XP_001938508.1| hypothetical protein PTRG_08176 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187985607|gb|EDU51095.1| hypothetical protein PTRG_08176 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 60 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/58 (63%), Positives = 41/58 (70%) Frame = -1 Query: 249 PPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 P M G+GRT+ EP +KENR+IVTA GMFAIGVTFLHSSWAEILLPA Sbjct: 3 PKSMMTGRGRTVAEPSFASSALQTFTNKENRTIVTAVGMFAIGVTFLHSSWAEILLPA 60 >ref|XP_003301156.1| hypothetical protein PTT_12591 [Pyrenophora teres f. teres 0-1] gi|311324335|gb|EFQ90746.1| hypothetical protein PTT_12591 [Pyrenophora teres f. teres 0-1] Length = 60 Score = 72.0 bits (175), Expect = 1e-10 Identities = 37/58 (63%), Positives = 39/58 (67%) Frame = -1 Query: 249 PPKQMAGKGRTLNEPXXXXXXXXXXXSKENRSIVTAAGMFAIGVTFLHSSWAEILLPA 76 P M G+GRT EP SKENR+I TA GMFAIGVTFLHSSWAEILLPA Sbjct: 3 PKSMMTGRGRTAAEPSFASSALQTFTSKENRTIFTAVGMFAIGVTFLHSSWAEILLPA 60