BLASTX nr result
ID: Forsythia21_contig00035518
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035518 (252 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ78679.1| hypothetical protein M438DRAFT_285197 [Aureobasid... 83 8e-14 >gb|KEQ78679.1| hypothetical protein M438DRAFT_285197 [Aureobasidium pullulans EXF-150] Length = 221 Score = 82.8 bits (203), Expect = 8e-14 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 2/65 (3%) Frame = -2 Query: 191 SHPPKI--PATINGEATTSHWKFYNHPKVELAGEDAFTITTPPATDLWRPDSKPTSDNFT 18 SHP I PATI ++S WK NHP++ + +F+ITTPPATDLWRP+++P SDNFT Sbjct: 2 SHPKHISLPATIGSNTSSSAWKTLNHPEIHVKDHKSFSITTPPATDLWRPNAEPKSDNFT 61 Query: 17 APFVY 3 P+VY Sbjct: 62 VPYVY 66