BLASTX nr result
ID: Forsythia21_contig00035414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035414 (582 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073256.1| PREDICTED: cytochrome c oxidase assembly fac... 148 2e-33 emb|CDO98272.1| unnamed protein product [Coffea canephora] 146 6e-33 ref|XP_012856231.1| PREDICTED: cytochrome c oxidase assembly fac... 144 2e-32 ref|XP_010108957.1| hypothetical protein L484_027152 [Morus nota... 140 3e-31 ref|XP_010069543.1| PREDICTED: cytochrome c oxidase assembly fac... 140 4e-31 ref|XP_007225036.1| hypothetical protein PRUPE_ppa019876mg, part... 140 5e-31 ref|XP_009609292.1| PREDICTED: cytochrome c oxidase assembly fac... 139 7e-31 ref|XP_004489024.1| PREDICTED: cytochrome c oxidase assembly fac... 139 7e-31 ref|XP_008812861.1| PREDICTED: mitochondrial protein pet191 homo... 139 9e-31 ref|XP_011032997.1| PREDICTED: cytochrome c oxidase assembly fac... 139 1e-30 ref|XP_008446948.1| PREDICTED: cytochrome c oxidase assembly fac... 138 2e-30 ref|XP_010271113.1| PREDICTED: cytochrome c oxidase assembly fac... 138 2e-30 ref|XP_002513609.1| conserved hypothetical protein [Ricinus comm... 138 2e-30 ref|XP_002315392.1| hypothetical protein POPTR_0010s25510g [Popu... 138 2e-30 ref|XP_002310953.2| hypothetical protein POPTR_0008s01080g [Popu... 137 3e-30 ref|XP_007029447.1| N-terminal [Theobroma cacao] gi|508718052|gb... 137 3e-30 ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly fac... 137 3e-30 ref|XP_009762795.1| PREDICTED: mitochondrial protein pet191 homo... 137 3e-30 ref|XP_006858712.1| PREDICTED: cytochrome c oxidase assembly fac... 137 3e-30 ref|XP_008220734.1| PREDICTED: cytochrome c oxidase assembly fac... 137 5e-30 >ref|XP_011073256.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Sesamum indicum] gi|747054128|ref|XP_011073257.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Sesamum indicum] Length = 71 Score = 148 bits (373), Expect = 2e-33 Identities = 69/71 (97%), Positives = 71/71 (100%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLAMELVKCLSESDCVKVENRPYRECAKEK+PKISSECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKAPKISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >emb|CDO98272.1| unnamed protein product [Coffea canephora] Length = 71 Score = 146 bits (369), Expect = 6e-33 Identities = 69/71 (97%), Positives = 70/71 (98%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEK+P ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKTPLISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_012856231.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Erythranthe guttatus] gi|604302193|gb|EYU21779.1| hypothetical protein MIMGU_mgv1a017497mg [Erythranthe guttata] Length = 71 Score = 144 bits (364), Expect = 2e-32 Identities = 68/71 (95%), Positives = 69/71 (97%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLA ELVKCLSESDCVKVENRPYRECAKEKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLATELVKCLSESDCVKVENRPYRECAKEKSPHISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010108957.1| hypothetical protein L484_027152 [Morus notabilis] gi|587933634|gb|EXC20597.1| hypothetical protein L484_027152 [Morus notabilis] Length = 71 Score = 140 bits (354), Expect = 3e-31 Identities = 67/71 (94%), Positives = 68/71 (95%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKVENR +RECA EKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVENRSFRECAGEKSPTISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010069543.1| PREDICTED: cytochrome c oxidase assembly factor 5 isoform X1 [Eucalyptus grandis] Length = 71 Score = 140 bits (353), Expect = 4e-31 Identities = 67/71 (94%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKVE R YRECA EKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSYRECAGEKSPSISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_007225036.1| hypothetical protein PRUPE_ppa019876mg, partial [Prunus persica] gi|462421972|gb|EMJ26235.1| hypothetical protein PRUPE_ppa019876mg, partial [Prunus persica] Length = 132 Score = 140 bits (352), Expect = 5e-31 Identities = 66/78 (84%), Positives = 70/78 (89%) Frame = -2 Query: 536 KKKGALEMSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFN 357 K+ G +M+KSCKGLAMELVKCLSE DCVKVE R YRECA EKSP ISSEC+GLRETYFN Sbjct: 55 KRVGKGQMAKSCKGLAMELVKCLSECDCVKVEKRSYRECAGEKSPSISSECIGLRETYFN 114 Query: 356 CKRGQVDMRARIRGNKGY 303 CKRGQVDMRARIRGNKGY Sbjct: 115 CKRGQVDMRARIRGNKGY 132 >ref|XP_009609292.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Nicotiana tomentosiformis] Length = 71 Score = 139 bits (351), Expect = 7e-31 Identities = 65/71 (91%), Positives = 68/71 (95%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLAMELVKCLSESDCVKVE +P+RECAKEKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVEKKPFRECAKEKSPLIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_004489024.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Cicer arietinum] Length = 71 Score = 139 bits (351), Expect = 7e-31 Identities = 65/71 (91%), Positives = 68/71 (95%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLA+ELVKCLSESDCVKVENR YREC+ EKSP ISSECVGLRETYFNCKRGQ+D Sbjct: 1 MSKSCKGLAVELVKCLSESDCVKVENRSYRECSGEKSPSISSECVGLRETYFNCKRGQID 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_008812861.1| PREDICTED: mitochondrial protein pet191 homolog [Phoenix dactylifera] Length = 71 Score = 139 bits (350), Expect = 9e-31 Identities = 66/71 (92%), Positives = 66/71 (92%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKVE RPYRECA EK P I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRPYRECAGEKVPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_011032997.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] gi|743868432|ref|XP_011032998.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] gi|743868436|ref|XP_011032999.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] gi|743868440|ref|XP_011033000.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Populus euphratica] Length = 71 Score = 139 bits (349), Expect = 1e-30 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDC+K+ENR Y+ECA EKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCIKIENRSYKECAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_008446948.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Cucumis melo] gi|778706779|ref|XP_011655913.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Cucumis sativus] gi|700197136|gb|KGN52313.1| hypothetical protein Csa_5G623760 [Cucumis sativus] Length = 71 Score = 138 bits (348), Expect = 2e-30 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKV+NR YRECA EKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVQNRTYRECAGEKSPCIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_010271113.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Nelumbo nucifera] Length = 71 Score = 138 bits (347), Expect = 2e-30 Identities = 65/71 (91%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSE+DCVKVE R YRECA EK+P ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVEKRSYRECAGEKAPSISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002513609.1| conserved hypothetical protein [Ricinus communis] gi|223547517|gb|EEF49012.1| conserved hypothetical protein [Ricinus communis] Length = 71 Score = 138 bits (347), Expect = 2e-30 Identities = 65/71 (91%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLAMELVKCLSESDCVKVE RPYRECA EKSP I SECVGLRETYFNCKRGQ+D Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVEKRPYRECAGEKSPCIPSECVGLRETYFNCKRGQLD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002315392.1| hypothetical protein POPTR_0010s25510g [Populus trichocarpa] gi|222864432|gb|EEF01563.1| hypothetical protein POPTR_0010s25510g [Populus trichocarpa] Length = 71 Score = 138 bits (347), Expect = 2e-30 Identities = 63/71 (88%), Positives = 68/71 (95%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLA+ELVKCLSESDC+K+E+RPY+ECA EKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLALELVKCLSESDCIKMEDRPYKECAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_002310953.2| hypothetical protein POPTR_0008s01080g [Populus trichocarpa] gi|550332116|gb|EEE88320.2| hypothetical protein POPTR_0008s01080g [Populus trichocarpa] Length = 71 Score = 137 bits (346), Expect = 3e-30 Identities = 63/71 (88%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDC+K+ENR Y++CA EKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCIKIENRSYKDCAGEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_007029447.1| N-terminal [Theobroma cacao] gi|508718052|gb|EOY09949.1| N-terminal [Theobroma cacao] Length = 71 Score = 137 bits (346), Expect = 3e-30 Identities = 66/71 (92%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSESDCVKVE R +RECA EKSP ISSECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESDCVKVEKRSFRECAGEKSPCISSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_003578454.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Brachypodium distachyon] gi|721681597|ref|XP_010238381.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Brachypodium distachyon] gi|326497105|dbj|BAK02137.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 71 Score = 137 bits (346), Expect = 3e-30 Identities = 63/71 (88%), Positives = 68/71 (95%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSE+DCVKV+ RPY+ECA EK+P I+SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSETDCVKVQKRPYKECAGEKAPNITSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_009762795.1| PREDICTED: mitochondrial protein pet191 homolog [Nicotiana sylvestris] Length = 71 Score = 137 bits (345), Expect = 3e-30 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLAMELVKCLSESDCVKVE + +RECAKEKSP I SECVGLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSESDCVKVEKKSFRECAKEKSPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_006858712.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Amborella trichopoda] gi|548862823|gb|ERN20179.1| hypothetical protein AMTR_s00066p00108160 [Amborella trichopoda] Length = 71 Score = 137 bits (345), Expect = 3e-30 Identities = 65/71 (91%), Positives = 66/71 (92%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 MSKSCKGLAMELVKCLSES+CVKVENR YRECA EK P I SECVGLRETYFNCKRGQVD Sbjct: 1 MSKSCKGLAMELVKCLSESNCVKVENRSYRECAGEKEPSIPSECVGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71 >ref|XP_008220734.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] gi|645227890|ref|XP_008220735.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] gi|645227892|ref|XP_008220736.1| PREDICTED: cytochrome c oxidase assembly factor 5 [Prunus mume] Length = 71 Score = 137 bits (344), Expect = 5e-30 Identities = 64/71 (90%), Positives = 66/71 (92%) Frame = -2 Query: 515 MSKSCKGLAMELVKCLSESDCVKVENRPYRECAKEKSPKISSECVGLRETYFNCKRGQVD 336 M+KSCKGLAMELVKCLSE DCVKVE R YRECA EKSP ISSEC+GLRETYFNCKRGQVD Sbjct: 1 MAKSCKGLAMELVKCLSECDCVKVEKRSYRECAGEKSPSISSECIGLRETYFNCKRGQVD 60 Query: 335 MRARIRGNKGY 303 MRARIRGNKGY Sbjct: 61 MRARIRGNKGY 71