BLASTX nr result
ID: Forsythia21_contig00035314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035314 (429 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU36368.1| hypothetical protein MIMGU_mgv1a017259mg [Erythra... 57 5e-06 gb|EYU25504.1| hypothetical protein MIMGU_mgv1a017249mg [Erythra... 57 5e-06 >gb|EYU36368.1| hypothetical protein MIMGU_mgv1a017259mg [Erythranthe guttata] Length = 86 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/41 (58%), Positives = 28/41 (68%), Gaps = 1/41 (2%) Frame = -3 Query: 427 YEDVHILWDMLKGNDKQLTGSGKGPFWD-IVHWAKCAPFLC 308 YEDVHILWDMLK + ++G KGP WD V WAK P +C Sbjct: 43 YEDVHILWDMLKRKETDMSGRRKGPMWDQFVRWAKHTPLIC 83 >gb|EYU25504.1| hypothetical protein MIMGU_mgv1a017249mg [Erythranthe guttata] Length = 86 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/44 (59%), Positives = 30/44 (68%), Gaps = 2/44 (4%) Frame = -3 Query: 427 YEDVHILWDMLKGNDK--QLTGSGKGPFWDIVHWAKCAPFLCHG 302 YEDVHILWDMLK ND+ + G + W + HWAKCAP LC G Sbjct: 43 YEDVHILWDMLKKNDETDPVKGGDEAAAWKL-HWAKCAPLLCRG 85