BLASTX nr result
ID: Forsythia21_contig00035193
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00035193 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja] 57 5e-06 >gb|KHN42349.1| hypothetical protein glysoja_020061 [Glycine soja] Length = 63 Score = 57.0 bits (136), Expect = 5e-06 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%) Frame = -1 Query: 391 MKSHAFVLAIKAIFVLIFFLLI----SNAMCIRLVKDDFSLSDPTMAGFIIERAYSGPSH 224 MK ++ +A AIF++IF LL+ +N R +KD S P G II RAYSGPSH Sbjct: 1 MKGYSLAVAFNAIFLVIFLLLLLSYSNNVESTRTLKDQSS--SPAFIGLIINRAYSGPSH 58 Query: 223 RGRGH 209 RG GH Sbjct: 59 RGAGH 63