BLASTX nr result
ID: Forsythia21_contig00034802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034802 (404 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP06850.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP06850.1| unnamed protein product [Coffea canephora] Length = 461 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 4/55 (7%) Frame = -2 Query: 403 SSTVKIADSVHELASMAKFK----NDVLKQTETGKGKVLRVPSIEGSHIIAITVE 251 SSTVKIADSVH+LAS+A+FK +D K + ++LR PSIEGSH + I+VE Sbjct: 407 SSTVKIADSVHQLASLARFKKISEDDASKSDQRNTERILRSPSIEGSHSLTISVE 461