BLASTX nr result
ID: Forsythia21_contig00034737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034737 (316 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520201.1| two-component sensor protein histidine prote... 62 1e-07 emb|CDP00229.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_012847768.1| PREDICTED: two-component response regulator ... 61 3e-07 ref|XP_011086463.1| PREDICTED: two-component response regulator ... 60 7e-07 ref|XP_010044664.1| PREDICTED: two-component response regulator ... 59 1e-06 ref|XP_007044474.1| Two-component response regulator ARR4 [Theob... 59 1e-06 ref|XP_003519320.1| PREDICTED: two-component response regulator ... 58 3e-06 ref|XP_003517746.1| PREDICTED: two-component response regulator ... 58 3e-06 ref|XP_007157523.1| hypothetical protein PHAVU_002G076900g [Phas... 58 3e-06 ref|XP_011071285.1| PREDICTED: two-component response regulator ... 57 4e-06 ref|XP_010100530.1| Two-component response regulator [Morus nota... 57 5e-06 ref|XP_009763113.1| PREDICTED: two-component response regulator ... 57 5e-06 ref|XP_009763112.1| PREDICTED: two-component response regulator ... 57 5e-06 ref|XP_009763111.1| PREDICTED: two-component response regulator ... 57 5e-06 ref|XP_012080154.1| PREDICTED: two-component response regulator ... 57 5e-06 ref|XP_006390374.1| hypothetical protein EUTSA_v10019119mg [Eutr... 57 5e-06 ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arab... 57 5e-06 ref|XP_010471585.1| PREDICTED: two-component response regulator ... 57 6e-06 ref|XP_010428484.1| PREDICTED: two-component response regulator ... 57 6e-06 ref|XP_012092019.1| PREDICTED: two-component response regulator ... 56 8e-06 >ref|XP_002520201.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] gi|223540693|gb|EEF42256.1| two-component sensor protein histidine protein kinase, putative [Ricinus communis] Length = 258 Score = 62.4 bits (150), Expect = 1e-07 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = -1 Query: 100 SSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSCD+ EVHVLAVDDS VDRKVIERLLKITSCK Sbjct: 22 SSCDNDEVHVLAVDDSLVDRKVIERLLKITSCK 54 >emb|CDP00229.1| unnamed protein product [Coffea canephora] Length = 251 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/57 (57%), Positives = 37/57 (64%) Frame = -1 Query: 172 MAKNLVFSXXXXXXXXXXXXXXLSSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 MA+N VFS ++S SHEVHVLAVDDS VDRKVIE+LLK TSCK Sbjct: 1 MARNGVFSRRRRPERMEEAGDLSATSLGSHEVHVLAVDDSLVDRKVIEKLLKTTSCK 57 >ref|XP_012847768.1| PREDICTED: two-component response regulator ARR5 [Erythranthe guttatus] gi|604316462|gb|EYU28654.1| hypothetical protein MIMGU_mgv1a012764mg [Erythranthe guttata] Length = 241 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 97 SCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SCDS EVHVLAVDDS VDRKVIE+LLKITSCK Sbjct: 28 SCDSDEVHVLAVDDSLVDRKVIEKLLKITSCK 59 >ref|XP_011086463.1| PREDICTED: two-component response regulator ARR17 [Sesamum indicum] Length = 240 Score = 59.7 bits (143), Expect = 7e-07 Identities = 34/57 (59%), Positives = 35/57 (61%) Frame = -1 Query: 172 MAKNLVFSXXXXXXXXXXXXXXLSSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 MAKN VFS + S HEVHVLAVDDS VDRKVIERLLKIT CK Sbjct: 1 MAKNGVFSRLRRLEKGEGVDDLSAYSDTHHEVHVLAVDDSLVDRKVIERLLKITCCK 57 >ref|XP_010044664.1| PREDICTED: two-component response regulator ARR6-like [Eucalyptus grandis] gi|629122274|gb|KCW86764.1| hypothetical protein EUGRSUZ_B03374 [Eucalyptus grandis] Length = 263 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -1 Query: 100 SSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S C S EVHVLAVDDS VDRKVIERLLKITSCK Sbjct: 23 SPCGSEEVHVLAVDDSLVDRKVIERLLKITSCK 55 >ref|XP_007044474.1| Two-component response regulator ARR4 [Theobroma cacao] gi|508708409|gb|EOY00306.1| Two-component response regulator ARR4 [Theobroma cacao] Length = 394 Score = 59.3 bits (142), Expect = 1e-06 Identities = 44/110 (40%), Positives = 58/110 (52%), Gaps = 8/110 (7%) Frame = -1 Query: 307 IFLIQTDSFTI----YITPNLSSSLHFL*ATNFRGFFERK----KVFYIFSKEMAKNLVF 152 +F + + FTI + + +L FL + FR F R+ VF+ + EMA+N Sbjct: 107 VFASRANKFTIVELGFSSFSLLEGFFFLLSFKFR--FHREIWLLSVFFFYYLEMARNGAV 164 Query: 151 SXXXXXXXXXXXXXXLSSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 + S DS EVHVLAVDDS VDRKVIERLL+I+SCK Sbjct: 165 TWRRRTEKIDGFDLSPS---DSEEVHVLAVDDSHVDRKVIERLLRISSCK 211 >ref|XP_003519320.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] Length = 240 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 91 DSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 DSHEVHVLAVDDS VDRKVIERLLKI++CK Sbjct: 16 DSHEVHVLAVDDSLVDRKVIERLLKISACK 45 >ref|XP_003517746.1| PREDICTED: two-component response regulator ARR4-like [Glycine max] gi|734313028|gb|KHN01128.1| Two-component response regulator ARR3 [Glycine soja] Length = 244 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 91 DSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 DSHEVHVLAVDDS VDRKVIERLLKI++CK Sbjct: 16 DSHEVHVLAVDDSLVDRKVIERLLKISACK 45 >ref|XP_007157523.1| hypothetical protein PHAVU_002G076900g [Phaseolus vulgaris] gi|125658123|gb|ABN48988.1| type A response regulator RR1 [Phaseolus vulgaris] gi|561030938|gb|ESW29517.1| hypothetical protein PHAVU_002G076900g [Phaseolus vulgaris] Length = 227 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -1 Query: 91 DSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 DSHEVHVLAVDDS VDRKVIERLLKI++CK Sbjct: 16 DSHEVHVLAVDDSLVDRKVIERLLKISACK 45 >ref|XP_011071285.1| PREDICTED: two-component response regulator ARR5-like [Sesamum indicum] Length = 222 Score = 57.4 bits (137), Expect = 4e-06 Identities = 36/58 (62%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -1 Query: 172 MAKNLVFSXXXXXXXXXXXXXXLSSSCDSHEVHVLAVDDSFVD-RKVIERLLKITSCK 2 MAKN VFS S+ DSHEVHVLAVDDS VD RKVIERLLKIT+CK Sbjct: 1 MAKNGVFSRLRRLEKSEDTDEF-SACIDSHEVHVLAVDDSLVDNRKVIERLLKITACK 57 >ref|XP_010100530.1| Two-component response regulator [Morus notabilis] gi|587894132|gb|EXB82664.1| Two-component response regulator [Morus notabilis] Length = 239 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -1 Query: 100 SSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S DS EVHVLAVDDS VDRKVIERLL+ITSCK Sbjct: 22 SPVDSEEVHVLAVDDSLVDRKVIERLLRITSCK 54 >ref|XP_009763113.1| PREDICTED: two-component response regulator ARR3-like isoform X3 [Nicotiana sylvestris] Length = 144 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 97 SCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S DS EVHVLAVDDS VDRKVIERLLKITSC+ Sbjct: 25 SLDSDEVHVLAVDDSLVDRKVIERLLKITSCR 56 >ref|XP_009763112.1| PREDICTED: two-component response regulator ARR3-like isoform X2 [Nicotiana sylvestris] Length = 147 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 97 SCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S DS EVHVLAVDDS VDRKVIERLLKITSC+ Sbjct: 25 SLDSDEVHVLAVDDSLVDRKVIERLLKITSCR 56 >ref|XP_009763111.1| PREDICTED: two-component response regulator ARR6-like isoform X1 [Nicotiana sylvestris] Length = 262 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 97 SCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S DS EVHVLAVDDS VDRKVIERLLKITSC+ Sbjct: 25 SLDSDEVHVLAVDDSLVDRKVIERLLKITSCR 56 >ref|XP_012080154.1| PREDICTED: two-component response regulator ARR5-like [Jatropha curcas] gi|643720897|gb|KDP31161.1| hypothetical protein JCGZ_11537 [Jatropha curcas] Length = 212 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSSC S E+HVLAVDDSFVDRKVIERLL+I+SCK Sbjct: 22 SSSC-SEELHVLAVDDSFVDRKVIERLLRISSCK 54 >ref|XP_006390374.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum] gi|557086808|gb|ESQ27660.1| hypothetical protein EUTSA_v10019119mg [Eutrema salsugineum] Length = 219 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSS S E+HVLAVDDSFVDRKVIERLL+I+SCK Sbjct: 7 SSSSSSPELHVLAVDDSFVDRKVIERLLRISSCK 40 >ref|XP_002888998.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. lyrata] gi|297334839|gb|EFH65257.1| hypothetical protein ARALYDRAFT_316423 [Arabidopsis lyrata subsp. lyrata] Length = 206 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSS S E+HVLAVDDSFVDRKVIERLLKI++CK Sbjct: 10 SSSSSSPELHVLAVDDSFVDRKVIERLLKISACK 43 >ref|XP_010471585.1| PREDICTED: two-component response regulator ARR15-like [Camelina sativa] gi|727597197|ref|XP_010471586.1| PREDICTED: two-component response regulator ARR15-like [Camelina sativa] Length = 200 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSS S E+HVLAVDDSFVDRKVIERLLKI++CK Sbjct: 8 SSSSASSELHVLAVDDSFVDRKVIERLLKISACK 41 >ref|XP_010428484.1| PREDICTED: two-component response regulator ARR15-like [Camelina sativa] gi|727504800|ref|XP_010428485.1| PREDICTED: two-component response regulator ARR15-like [Camelina sativa] Length = 201 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 SSS S E+HVLAVDDSFVDRKVIERLLKI++CK Sbjct: 8 SSSSASSELHVLAVDDSFVDRKVIERLLKISACK 41 >ref|XP_012092019.1| PREDICTED: two-component response regulator ARR5 [Jatropha curcas] gi|643704220|gb|KDP21284.1| hypothetical protein JCGZ_21755 [Jatropha curcas] Length = 252 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 103 SSSCDSHEVHVLAVDDSFVDRKVIERLLKITSCK 2 S S D EVHVLAVDDS +DRKVIERLLKI+SCK Sbjct: 22 SPSSDDQEVHVLAVDDSLIDRKVIERLLKISSCK 55