BLASTX nr result
ID: Forsythia21_contig00034709
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034709 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMF08566.1| hypothetical protein SEPMUDRAFT_159425 [Sphaeruli... 122 1e-25 ref|XP_003848216.1| hypothetical protein MYCGRDRAFT_106278, part... 119 6e-25 gb|KJX98555.1| glutathione reductase like protein [Zymoseptoria ... 119 8e-25 ref|XP_007675788.1| hypothetical protein BAUCODRAFT_449844 [Baud... 119 1e-24 ref|XP_007924287.1| hypothetical protein MYCFIDRAFT_53160 [Pseud... 115 9e-24 gb|EME38552.1| hypothetical protein DOTSEDRAFT_181781 [Dothistro... 112 8e-23 gb|EKG21863.1| hypothetical protein MPH_00783 [Macrophomina phas... 110 5e-22 ref|XP_007579872.1| putative glutathione reductase protein [Neof... 109 8e-22 gb|KKY23383.1| putative glutathione reductase [Diplodia seriata] 107 2e-21 gb|KEQ58142.1| hypothetical protein M437DRAFT_79243 [Aureobasidi... 104 3e-20 gb|KEQ74993.1| hypothetical protein M436DRAFT_42675 [Aureobasidi... 103 5e-20 emb|CCF43062.1| glutathione reductase [Colletotrichum higginsianum] 103 6e-20 gb|KEY67436.1| hypothetical protein S7711_05964 [Stachybotrys ch... 101 2e-19 gb|EPB87086.1| glutathione reductase (NADPH) [Mucor circinelloid... 101 2e-19 gb|KLO91590.1| putative glutathione reductase (NADPH) [Fusarium ... 101 2e-19 emb|CCT67226.1| probable glutathione reductase (NADPH) [Fusarium... 101 2e-19 ref|XP_006674398.1| glutathione reductase [Cordyceps militaris C... 101 2e-19 gb|KHO01923.1| glutathione-disulfide reductase [Metarhizium albu... 100 3e-19 ref|XP_001909415.1| hypothetical protein [Podospora anserina S m... 100 3e-19 gb|KJK81014.1| Glutathione reductase [Metarhizium anisopliae BRI... 100 4e-19 >gb|EMF08566.1| hypothetical protein SEPMUDRAFT_159425 [Sphaerulina musiva SO2202] Length = 554 Score = 122 bits (305), Expect = 1e-25 Identities = 58/75 (77%), Positives = 65/75 (86%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYLHGTASF D+H V V LDD++EV +KAK ILIAVGG P+IPD+ Sbjct: 188 LNGIYEKNLKNDKVEYLHGTASFKDQHTVSVKLDDESEVSIKAKKILIAVGGHPSIPDVE 247 Query: 183 GAELGITSDGFFDLE 227 GAE GITSDGFF+LE Sbjct: 248 GAEHGITSDGFFELE 262 >ref|XP_003848216.1| hypothetical protein MYCGRDRAFT_106278, partial [Zymoseptoria tritici IPO323] gi|339468090|gb|EGP83192.1| hypothetical protein MYCGRDRAFT_106278, partial [Zymoseptoria tritici IPO323] Length = 357 Score = 119 bits (299), Expect = 6e-25 Identities = 56/75 (74%), Positives = 64/75 (85%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYLHGTA+F D H V V LDD+TE+ +KAK IL+AVGG PN+P + Sbjct: 99 LNGIYEKNLKNDKVEYLHGTATFKDPHVVTVTLDDKTEIDIKAKKILVAVGGYPNLPPVE 158 Query: 183 GAELGITSDGFFDLE 227 GAELGITSDGFF+LE Sbjct: 159 GAELGITSDGFFELE 173 >gb|KJX98555.1| glutathione reductase like protein [Zymoseptoria brevis] Length = 465 Score = 119 bits (298), Expect = 8e-25 Identities = 56/75 (74%), Positives = 63/75 (84%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYLHGTA+F D H V V LDD TE+ +KAK IL+AVGG PN+P + Sbjct: 99 LNGIYEKNLKNDKVEYLHGTATFKDPHVVTVTLDDNTEIDIKAKKILVAVGGYPNLPPVE 158 Query: 183 GAELGITSDGFFDLE 227 GAELGITSDGFF+LE Sbjct: 159 GAELGITSDGFFELE 173 >ref|XP_007675788.1| hypothetical protein BAUCODRAFT_449844 [Baudoinia compniacensis UAMH 10762] gi|449301367|gb|EMC97378.1| hypothetical protein BAUCODRAFT_449844 [Baudoinia compniacensis UAMH 10762] Length = 466 Score = 119 bits (297), Expect = 1e-24 Identities = 55/75 (73%), Positives = 63/75 (84%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYLHG ASF D H VKV LDD++EV +KAK IL+AVGG PN P + Sbjct: 100 LNGIYEKNLHNDKVEYLHGFASFADPHTVKVTLDDKSEVDIKAKQILVAVGGHPNFPSVE 159 Query: 183 GAELGITSDGFFDLE 227 GAELGITSDGFF+++ Sbjct: 160 GAELGITSDGFFEID 174 >ref|XP_007924287.1| hypothetical protein MYCFIDRAFT_53160 [Pseudocercospora fijiensis CIRAD86] gi|452985232|gb|EME84989.1| hypothetical protein MYCFIDRAFT_53160 [Pseudocercospora fijiensis CIRAD86] Length = 465 Score = 115 bits (289), Expect = 9e-24 Identities = 55/74 (74%), Positives = 62/74 (83%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYLHG ASF D H V+VVLDD++EV +KAK IL+AVGG PN P + Sbjct: 99 LNGIYEKNLKNDKVEYLHGLASFQDPHTVRVVLDDKSEVDIKAKKILVAVGGHPNYPPVE 158 Query: 183 GAELGITSDGFFDL 224 GAE GITSDGFF+L Sbjct: 159 GAEHGITSDGFFEL 172 >gb|EME38552.1| hypothetical protein DOTSEDRAFT_181781 [Dothistroma septosporum NZE10] Length = 465 Score = 112 bits (281), Expect = 8e-23 Identities = 55/75 (73%), Positives = 65/75 (86%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIP-DI 179 LNGIYEKNL NDKVEYLHGTASF D H+V+V LDD++ V +KAK IL+AVGG PNIP +I Sbjct: 99 LNGIYEKNLKNDKVEYLHGTASFQDPHSVRVELDDKSHVDIKAKKILVAVGGFPNIPSNI 158 Query: 180 PGAELGITSDGFFDL 224 GA+LGITSDGFF++ Sbjct: 159 EGADLGITSDGFFEI 173 >gb|EKG21863.1| hypothetical protein MPH_00783 [Macrophomina phaseolina MS6] Length = 466 Score = 110 bits (274), Expect = 5e-22 Identities = 53/75 (70%), Positives = 62/75 (82%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYE+NLSNDKVEY+HG ASF+D + V+V LDD + VKAK+ILIAVGG P +PDIP Sbjct: 98 LNGIYERNLSNDKVEYIHGFASFVDRNTVEVSLDDGGKQTVKAKHILIAVGGHPTLPDIP 157 Query: 183 GAELGITSDGFFDLE 227 G EL I SDGFFD+E Sbjct: 158 GKELCIDSDGFFDIE 172 >ref|XP_007579872.1| putative glutathione reductase protein [Neofusicoccum parvum UCRNP2] gi|485929201|gb|EOD52653.1| putative glutathione reductase protein [Neofusicoccum parvum UCRNP2] Length = 466 Score = 109 bits (272), Expect = 8e-22 Identities = 52/75 (69%), Positives = 63/75 (84%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYE+NL+NDKVEY+HG ASF+D++ V+V LDD + VKAK+ILIAVGG P +PDIP Sbjct: 98 LNGIYERNLTNDKVEYIHGFASFVDKNTVEVKLDDGGKETVKAKHILIAVGGHPTLPDIP 157 Query: 183 GAELGITSDGFFDLE 227 G EL I SDGFFD+E Sbjct: 158 GKELCIDSDGFFDIE 172 >gb|KKY23383.1| putative glutathione reductase [Diplodia seriata] Length = 466 Score = 107 bits (268), Expect = 2e-21 Identities = 52/75 (69%), Positives = 61/75 (81%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEY+HG ASF D++ V++ LDD + VKAK+ILIAVGG P +PDIP Sbjct: 98 LNGIYEKNLGNDKVEYIHGFASFQDKNTVEITLDDGGKEVVKAKHILIAVGGHPTLPDIP 157 Query: 183 GAELGITSDGFFDLE 227 G EL I SDGFFD+E Sbjct: 158 GKELCIDSDGFFDIE 172 >gb|KEQ58142.1| hypothetical protein M437DRAFT_79243 [Aureobasidium melanogenum CBS 110374] Length = 464 Score = 104 bits (259), Expect = 3e-20 Identities = 52/75 (69%), Positives = 61/75 (81%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYL+GTASF+ + VKVV D E +V+AK ILIAVGG+P+ D+ Sbjct: 99 LNGIYEKNLKNDKVEYLNGTASFVSKDVVKVVGQDGQEQQVRAKKILIAVGGRPSTIDVE 158 Query: 183 GAELGITSDGFFDLE 227 GAELGI SDGFF+LE Sbjct: 159 GAELGINSDGFFELE 173 >gb|KEQ74993.1| hypothetical protein M436DRAFT_42675 [Aureobasidium namibiae CBS 147.97] Length = 464 Score = 103 bits (257), Expect = 5e-20 Identities = 51/75 (68%), Positives = 61/75 (81%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYEKNL NDKVEYL+GTASF+ + VKVV D E +V+AK IL+AVGG+P+ ++ Sbjct: 99 LNGIYEKNLKNDKVEYLNGTASFVSKDVVKVVGQDGQEQQVRAKKILVAVGGRPSTINVE 158 Query: 183 GAELGITSDGFFDLE 227 GAELGI SDGFFDLE Sbjct: 159 GAELGINSDGFFDLE 173 >emb|CCF43062.1| glutathione reductase [Colletotrichum higginsianum] Length = 469 Score = 103 bits (256), Expect = 6e-20 Identities = 51/76 (67%), Positives = 59/76 (77%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL+NDKVEYLHG A + +V LDD T+ VKAK ILIAVGG P I P+I Sbjct: 99 LNGIYERNLNNDKVEYLHGWAKLTSRNEAEVTLDDGTKALVKAKKILIAVGGNPTIPPNI 158 Query: 180 PGAELGITSDGFFDLE 227 PGAELGI SDGFFD++ Sbjct: 159 PGAELGINSDGFFDID 174 >gb|KEY67436.1| hypothetical protein S7711_05964 [Stachybotrys chartarum IBT 7711] gi|667515147|gb|KFA45446.1| hypothetical protein S40293_10145 [Stachybotrys chartarum IBT 40293] Length = 469 Score = 101 bits (252), Expect = 2e-19 Identities = 50/76 (65%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL+ DKVEYLHG A + + V+V LDD ++V VKAK IL+AVGGKP P I Sbjct: 99 LNGIYERNLNKDKVEYLHGWARLLSKDEVEVTLDDGSKVVVKAKKILVAVGGKPTAPPPI 158 Query: 180 PGAELGITSDGFFDLE 227 PGAELGI SDGFFD++ Sbjct: 159 PGAELGINSDGFFDID 174 >gb|EPB87086.1| glutathione reductase (NADPH) [Mucor circinelloides f. circinelloides 1006PhL] Length = 466 Score = 101 bits (252), Expect = 2e-19 Identities = 48/75 (64%), Positives = 59/75 (78%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNIPDIP 182 LNGIYE+NL NDKVE++ G ASF+D++ V+V + ++V+AK ILIA GG P IPDIP Sbjct: 100 LNGIYERNLGNDKVEHIQGFASFVDKNTVRVQKSETESIEVQAKKILIATGGHPLIPDIP 159 Query: 183 GAELGITSDGFFDLE 227 GA LGI SDGFFDLE Sbjct: 160 GAHLGIDSDGFFDLE 174 >gb|KLO91590.1| putative glutathione reductase (NADPH) [Fusarium fujikuroi] Length = 469 Score = 101 bits (251), Expect = 2e-19 Identities = 48/75 (64%), Positives = 59/75 (78%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL+NDKV+YLHG A + ++ +V LDD ++V V AK IL+AVGGKP I PDI Sbjct: 99 LNGIYERNLNNDKVDYLHGWARLVSKNQAEVTLDDNSKVLVNAKKILVAVGGKPTIPPDI 158 Query: 180 PGAELGITSDGFFDL 224 PGAE G SDGFFD+ Sbjct: 159 PGAEYGTNSDGFFDI 173 >emb|CCT67226.1| probable glutathione reductase (NADPH) [Fusarium fujikuroi IMI 58289] gi|829114948|gb|KLO91334.1| putative glutathione reductase (NADPH) [Fusarium fujikuroi] gi|829149994|gb|KLP18767.1| putative glutathione reductase (NADPH) [Fusarium fujikuroi] Length = 469 Score = 101 bits (251), Expect = 2e-19 Identities = 48/75 (64%), Positives = 59/75 (78%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL+NDKV+YLHG A + ++ +V LDD ++V V AK IL+AVGGKP I PDI Sbjct: 99 LNGIYERNLNNDKVDYLHGWARLVSKNQAEVTLDDNSKVLVNAKKILVAVGGKPTIPPDI 158 Query: 180 PGAELGITSDGFFDL 224 PGAE G SDGFFD+ Sbjct: 159 PGAEYGTNSDGFFDI 173 >ref|XP_006674398.1| glutathione reductase [Cordyceps militaris CM01] gi|346318462|gb|EGX88065.1| glutathione reductase [Cordyceps militaris CM01] Length = 525 Score = 101 bits (251), Expect = 2e-19 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL NDKVEYLHG+ + ++ V+V LDD ++V V AK IL+AVGG+P+ P I Sbjct: 155 LNGIYERNLGNDKVEYLHGSGRLVSKNQVEVTLDDGSKVLVNAKKILVAVGGRPSAPPSI 214 Query: 180 PGAELGITSDGFFDL 224 PGAELGI SDGFFD+ Sbjct: 215 PGAELGINSDGFFDI 229 >gb|KHO01923.1| glutathione-disulfide reductase [Metarhizium album ARSEF 1941] Length = 469 Score = 100 bits (250), Expect = 3e-19 Identities = 49/76 (64%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL NDKVEYLHG + + V+V LDD ++V VKAK ILIAVGG+P+ P I Sbjct: 99 LNGIYERNLENDKVEYLHGWGRLLSRNQVEVKLDDGSKVLVKAKKILIAVGGRPSSPPQI 158 Query: 180 PGAELGITSDGFFDLE 227 PGAELG+ SDGFFD++ Sbjct: 159 PGAELGVNSDGFFDID 174 >ref|XP_001909415.1| hypothetical protein [Podospora anserina S mat+] gi|170944437|emb|CAP70548.1| unnamed protein product [Podospora anserina S mat+] gi|681097091|emb|CDP27135.1| Putative glutathione reductase [Podospora anserina S mat+] Length = 510 Score = 100 bits (250), Expect = 3e-19 Identities = 47/76 (61%), Positives = 63/76 (82%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL+NDKVEY+HG A + +++V+V LDD ++ V AK ILIAVGG P++ P+I Sbjct: 135 LNGIYERNLANDKVEYIHGWAKLLSKNSVEVTLDDGSKEVVNAKKILIAVGGNPHVPPEI 194 Query: 180 PGAELGITSDGFFDLE 227 PG+ELGI SDGFFD++ Sbjct: 195 PGSELGINSDGFFDID 210 >gb|KJK81014.1| Glutathione reductase [Metarhizium anisopliae BRIP 53293] gi|770411247|gb|KJK96023.1| Glutathione reductase [Metarhizium anisopliae BRIP 53284] Length = 469 Score = 100 bits (249), Expect = 4e-19 Identities = 49/76 (64%), Positives = 60/76 (78%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LNGIYEKNLSNDKVEYLHGTASFIDEHNVKVVLDDQTEVKVKAKNILIAVGGKPNI-PDI 179 LNGIYE+NL NDKVEYLHG + ++ V+V LDD ++V V AK ILIAVGG+P+ P I Sbjct: 99 LNGIYERNLGNDKVEYLHGWGRLLSKNQVEVTLDDGSKVVVNAKKILIAVGGRPSSPPQI 158 Query: 180 PGAELGITSDGFFDLE 227 PGAELGI SDGFFD++ Sbjct: 159 PGAELGINSDGFFDID 174