BLASTX nr result
ID: Forsythia21_contig00034671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034671 (371 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KEQ71365.1| hypothetical protein M436DRAFT_74433 [Aureobasidi... 57 5e-06 >gb|KEQ71365.1| hypothetical protein M436DRAFT_74433 [Aureobasidium namibiae CBS 147.97] Length = 189 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/86 (38%), Positives = 42/86 (48%), Gaps = 1/86 (1%) Frame = -2 Query: 256 DPDFVRRQQEFEPEWVK-DNPLFPGTEPEXXXXXXXXXXQKKHDSFYKQELRQEGLXXXX 80 D + ++ +Q+FEPE+ D F G++ E QKKH+ FYKQELRQ GL Sbjct: 4 DEEIIKARQDFEPEYPSGDEKRFQGSQEEQAQNQRTVTQQKKHNEFYKQELRQTGLQTER 63 Query: 79 XXXXXXXXXXXXXXXXXRDGKYMHTN 2 RDGKYMHTN Sbjct: 64 SRSSSRRARRKRVKNDQRDGKYMHTN 89