BLASTX nr result
ID: Forsythia21_contig00034648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034648 (258 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007781990.1| cytochrome c1, heme protein, mitochondrial [... 97 4e-18 gb|KEQ85136.1| hypothetical protein M438DRAFT_208251 [Aureobasid... 92 1e-16 gb|KEQ75853.1| cytochrome C1 [Aureobasidium namibiae CBS 147.97] 89 9e-16 gb|KEQ58300.1| hypothetical protein M437DRAFT_79155 [Aureobasidi... 87 4e-15 gb|KEQ93385.1| hypothetical protein AUEXF2481DRAFT_6898 [Aureoba... 85 2e-14 ref|XP_007929248.1| hypothetical protein MYCFIDRAFT_86820 [Pseud... 77 4e-12 ref|XP_007587302.1| putative cytochrome c1 protein [Neofusicoccu... 73 6e-11 gb|EKG14999.1| Cytochrome c1 [Macrophomina phaseolina MS6] 73 6e-11 gb|KKY16700.1| putative cytochrome mitochondrial precursor [Dipl... 72 1e-10 gb|EME39366.1| hypothetical protein DOTSEDRAFT_75165 [Dothistrom... 72 2e-10 gb|KIW03313.1| cytochrome c1, heme protein, mitochondrial [Verru... 71 2e-10 gb|EMF10005.1| cytochrome c1 heme protein [Sphaerulina musiva SO... 70 5e-10 ref|XP_003833503.1| hypothetical protein LEMA_P062640.1 [Leptosp... 70 7e-10 dbj|GAM82554.1| hypothetical protein ANO11243_005360 [fungal sp.... 69 2e-09 ref|XP_003850699.1| cytochrome c1 [Zymoseptoria tritici IPO323] ... 68 2e-09 ref|XP_003298933.1| hypothetical protein PTT_09805 [Pyrenophora ... 68 3e-09 ref|XP_001933054.1| cytochrome c1, mitochondrial precursor [Pyre... 67 3e-09 ref|XP_008719571.1| cytochrome c1, heme protein, mitochondrial [... 66 1e-08 gb|KIN03922.1| hypothetical protein OIDMADRAFT_102286 [Oidiodend... 65 2e-08 gb|KDB26868.1| cytochrome c1, heme protein, mitochondrial [Trich... 65 2e-08 >ref|XP_007781990.1| cytochrome c1, heme protein, mitochondrial [Coniosporium apollinis CBS 100218] gi|494830107|gb|EON66673.1| cytochrome c1, heme protein, mitochondrial [Coniosporium apollinis CBS 100218] Length = 341 Score = 97.1 bits (240), Expect = 4e-18 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSSSRPDVKM 95 MGWKVMA+ G LF +S+WVKRYKWSTIKTRKLVYNPPVS A KNPSS+RP V+M Sbjct: 279 MGWKVMAIGGVLFALSVWVKRYKWSTIKTRKLVYNPPVSKADKNPSSARPGVRM 332 >gb|KEQ85136.1| hypothetical protein M438DRAFT_208251 [Aureobasidium pullulans EXF-150] Length = 337 Score = 92.0 bits (227), Expect = 1e-16 Identities = 39/56 (69%), Positives = 47/56 (83%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSSSRPDVKMRG 89 MGWKVMAV GTLF +S+WVKRYKW+ +KTRKLVYNPP + A +NPSS R +VK+ G Sbjct: 277 MGWKVMAVAGTLFALSVWVKRYKWTVVKTRKLVYNPPTTKAVRNPSSPRAEVKIDG 332 >gb|KEQ75853.1| cytochrome C1 [Aureobasidium namibiae CBS 147.97] Length = 268 Score = 89.4 bits (220), Expect = 9e-16 Identities = 38/56 (67%), Positives = 45/56 (80%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSSSRPDVKMRG 89 MGWKVMAV GTLF +S+WVKRYKW+ +KTRKLVYNPP + A +NPSS R +V G Sbjct: 208 MGWKVMAVAGTLFALSVWVKRYKWTVVKTRKLVYNPPTTKAIRNPSSPRTEVHTEG 263 >gb|KEQ58300.1| hypothetical protein M437DRAFT_79155 [Aureobasidium melanogenum CBS 110374] Length = 337 Score = 87.0 bits (214), Expect = 4e-15 Identities = 37/56 (66%), Positives = 43/56 (76%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSSSRPDVKMRG 89 MGWKVMAV GTLF +S+WVKRYKW+ +KTRKLVYNPP + A +NPSS R G Sbjct: 277 MGWKVMAVAGTLFALSVWVKRYKWTVVKTRKLVYNPPTTKAVRNPSSPRVQTHTEG 332 >gb|KEQ93385.1| hypothetical protein AUEXF2481DRAFT_6898 [Aureobasidium subglaciale EXF-2481] Length = 345 Score = 84.7 bits (208), Expect = 2e-14 Identities = 39/64 (60%), Positives = 47/64 (73%), Gaps = 8/64 (12%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKR--------YKWSTIKTRKLVYNPPVSAAAKNPSSSRPDV 101 MGWKVMAV GTLF +S+WVKR YKW+ +KTRKLVYNPP + A +NPSS R +V Sbjct: 277 MGWKVMAVAGTLFALSVWVKRQVAILRKAYKWTVVKTRKLVYNPPTTKAVRNPSSPRAEV 336 Query: 100 KMRG 89 K+ G Sbjct: 337 KIDG 340 >ref|XP_007929248.1| hypothetical protein MYCFIDRAFT_86820 [Pseudocercospora fijiensis CIRAD86] gi|452980481|gb|EME80242.1| hypothetical protein MYCFIDRAFT_86820 [Pseudocercospora fijiensis CIRAD86] Length = 329 Score = 77.0 bits (188), Expect = 4e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSS 116 MGWKVMA+ TLFV+S+WVKRYKWSTIKTRK+ YNPP + K P S Sbjct: 279 MGWKVMAIGTTLFVMSVWVKRYKWSTIKTRKIAYNPPKTPQPKQPGS 325 >ref|XP_007587302.1| putative cytochrome c1 protein [Neofusicoccum parvum UCRNP2] gi|485918584|gb|EOD45225.1| putative cytochrome c1 protein [Neofusicoccum parvum UCRNP2] Length = 322 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVS 140 MGWKV+AV LF +S+WVKRYKWSTIKTR+LVYNPPVS Sbjct: 280 MGWKVLAVGSVLFALSVWVKRYKWSTIKTRQLVYNPPVS 318 >gb|EKG14999.1| Cytochrome c1 [Macrophomina phaseolina MS6] Length = 322 Score = 73.2 bits (178), Expect = 6e-11 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVS 140 MGWKV+AV LF +S+WVKRYKWSTIKTR+LVYNPPVS Sbjct: 280 MGWKVLAVGSVLFALSVWVKRYKWSTIKTRQLVYNPPVS 318 >gb|KKY16700.1| putative cytochrome mitochondrial precursor [Diplodia seriata] Length = 322 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVS 140 MGWKV+AV LF +S+WVKRYKWSTIKTR+LVYNPPV+ Sbjct: 280 MGWKVLAVGSVLFALSVWVKRYKWSTIKTRQLVYNPPVT 318 >gb|EME39366.1| hypothetical protein DOTSEDRAFT_75165 [Dothistroma septosporum NZE10] Length = 328 Score = 71.6 bits (174), Expect = 2e-10 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNP 122 MGWKVM + TLF +S+WVKRYKWSTIKTRKL Y PP ++ K P Sbjct: 278 MGWKVMVIGTTLFAMSVWVKRYKWSTIKTRKLAYQPPSASQPKQP 322 >gb|KIW03313.1| cytochrome c1, heme protein, mitochondrial [Verruconis gallopava] Length = 328 Score = 71.2 bits (173), Expect = 2e-10 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAA 131 MGWKVMA TG LF +S+WVKRYKWS +KTRKLVY PP + A Sbjct: 282 MGWKVMAATGVLFALSVWVKRYKWSPLKTRKLVYTPPPAPPA 323 >gb|EMF10005.1| cytochrome c1 heme protein [Sphaerulina musiva SO2202] Length = 330 Score = 70.1 bits (170), Expect = 5e-10 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNPSS 116 MGWKVMA+ LF +S+WVKRYKWSTIKTRK+ Y PP S+ P S Sbjct: 280 MGWKVMAIGSVLFAMSVWVKRYKWSTIKTRKISYTPPPSSERPAPGS 326 >ref|XP_003833503.1| hypothetical protein LEMA_P062640.1 [Leptosphaeria maculans JN3] gi|312210051|emb|CBX90138.1| hypothetical protein LEMA_P062640.1 [Leptosphaeria maculans JN3] Length = 388 Score = 69.7 bits (169), Expect = 7e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPP 146 MGWKV+AVT LF IS+WVKRYKW+ +KTRKL+YNPP Sbjct: 332 MGWKVLAVTSVLFAISVWVKRYKWAPLKTRKLMYNPP 368 >dbj|GAM82554.1| hypothetical protein ANO11243_005360 [fungal sp. No.11243] Length = 317 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAA 134 MGWKV+AV+ LF +S+WVKRYKWS +KTRK+VYNPP +A+ Sbjct: 276 MGWKVLAVSSALFGLSVWVKRYKWSGMKTRKIVYNPPKAAS 316 >ref|XP_003850699.1| cytochrome c1 [Zymoseptoria tritici IPO323] gi|339470578|gb|EGP85675.1| hypothetical protein MYCGRDRAFT_60824 [Zymoseptoria tritici IPO323] gi|796710547|gb|KJY01498.1| cytochrome c1 like protein [Zymoseptoria brevis] Length = 328 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAKNP 122 MGWKVMA+ G LF +S+WVKRYKWST+KTRK+ Y P + + K P Sbjct: 278 MGWKVMAIGGLLFGMSVWVKRYKWSTVKTRKITYTAPPTNSPKQP 322 >ref|XP_003298933.1| hypothetical protein PTT_09805 [Pyrenophora teres f. teres 0-1] gi|311327613|gb|EFQ92970.1| hypothetical protein PTT_09805 [Pyrenophora teres f. teres 0-1] Length = 491 Score = 67.8 bits (164), Expect = 3e-09 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPP 146 MGWKV+AVT LF IS+WVKRYKW+ +KTRK+VY PP Sbjct: 435 MGWKVLAVTSVLFAISVWVKRYKWAPLKTRKIVYQPP 471 >ref|XP_001933054.1| cytochrome c1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187978618|gb|EDU45244.1| cytochrome c1, mitochondrial precursor [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 336 Score = 67.4 bits (163), Expect = 3e-09 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPP 146 MGWKV+AVT LF IS+WVKRYKW+ +KTRK++Y PP Sbjct: 280 MGWKVLAVTSVLFAISVWVKRYKWAPLKTRKIIYQPP 316 >ref|XP_008719571.1| cytochrome c1, heme protein, mitochondrial [Cyphellophora europaea CBS 101466] gi|568116362|gb|ETN38982.1| cytochrome c1, heme protein, mitochondrial [Cyphellophora europaea CBS 101466] Length = 339 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAAAK 128 MG KV+ VT LF +SIWVKRYKWS +KTRKLVYNPP + Sbjct: 296 MGLKVLVVTSALFALSIWVKRYKWSPVKTRKLVYNPPAETKVR 338 >gb|KIN03922.1| hypothetical protein OIDMADRAFT_102286 [Oidiodendron maius Zn] Length = 322 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPVSAA 134 MGWKV+A+T L+ +S+WVKRYKW+ +K RKLVY PPV A Sbjct: 279 MGWKVIALTSALWAVSVWVKRYKWAHLKNRKLVYTPPVPRA 319 >gb|KDB26868.1| cytochrome c1, heme protein, mitochondrial [Trichophyton interdigitale MR816] Length = 224 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 256 MGWKVMAVTGTLFVISIWVKRYKWSTIKTRKLVYNPPV 143 MG K + + TLF IS+WVKRYKW+TIKTRK+VYNPP+ Sbjct: 183 MGMKAVVLLSTLFAISVWVKRYKWATIKTRKIVYNPPI 220