BLASTX nr result
ID: Forsythia21_contig00034112
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00034112 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071956.1| PREDICTED: pentatricopeptide repeat-containi... 187 3e-45 ref|XP_012855660.1| PREDICTED: pentatricopeptide repeat-containi... 175 9e-42 gb|EYU22186.1| hypothetical protein MIMGU_mgv1a005737mg [Erythra... 175 9e-42 ref|XP_009782591.1| PREDICTED: pentatricopeptide repeat-containi... 173 5e-41 ref|XP_009587009.1| PREDICTED: pentatricopeptide repeat-containi... 172 6e-41 emb|CDP12719.1| unnamed protein product [Coffea canephora] 166 7e-39 ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containi... 162 1e-37 ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containi... 157 3e-36 ref|XP_010519534.1| PREDICTED: pentatricopeptide repeat-containi... 156 6e-36 ref|XP_009362936.1| PREDICTED: pentatricopeptide repeat-containi... 155 8e-36 ref|XP_008239337.1| PREDICTED: pentatricopeptide repeat-containi... 154 2e-35 ref|XP_008392892.1| PREDICTED: pentatricopeptide repeat-containi... 154 3e-35 ref|XP_007210500.1| hypothetical protein PRUPE_ppa002676mg [Prun... 153 4e-35 gb|KDO69474.1| hypothetical protein CISIN_1g037477mg [Citrus sin... 153 5e-35 ref|XP_006476892.1| PREDICTED: pentatricopeptide repeat-containi... 153 5e-35 ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containi... 152 6e-35 gb|EPS62186.1| hypothetical protein M569_12607 [Genlisea aurea] 152 6e-35 ref|XP_006439927.1| hypothetical protein CICLE_v10019266mg [Citr... 151 1e-34 ref|XP_002511313.1| pentatricopeptide repeat-containing protein,... 149 5e-34 ref|XP_008380527.1| PREDICTED: pentatricopeptide repeat-containi... 149 7e-34 >ref|XP_011071956.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Sesamum indicum] Length = 625 Score = 187 bits (474), Expect = 3e-45 Identities = 87/113 (76%), Positives = 99/113 (87%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R FKW+ SLGF+HN+VTYNGILRVLCWE+SI EFWS++ EMKSAGFE+D+DTYIKV RQ Sbjct: 252 RFFKWVDESLGFKHNSVTYNGILRVLCWEDSISEFWSVLEEMKSAGFELDIDTYIKVSRQ 311 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 QKNKML DAV+LYEHMMDS FKPSVKEC +LLR I+T PDLDLV+RVVNK Sbjct: 312 LQKNKMLGDAVKLYEHMMDSSFKPSVKECNLLLRAIATHSAPDLDLVYRVVNK 364 >ref|XP_012855660.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Erythranthe guttatus] Length = 623 Score = 175 bits (444), Expect = 9e-42 Identities = 83/111 (74%), Positives = 91/111 (81%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ SL F+HN VTYNGILRVLCWE+SI EFW ++ EMK AGFE+D+DTYIKV RQ Q Sbjct: 252 FKWVERSLNFKHNGVTYNGILRVLCWEDSISEFWFVMDEMKGAGFELDIDTYIKVSRQLQ 311 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 KNKML DAV LYEHMMDS FKPS EC LLRTI+T PDLDLVFRVVNK Sbjct: 312 KNKMLGDAVNLYEHMMDSSFKPSFTECNSLLRTIATYTTPDLDLVFRVVNK 362 Score = 56.6 bits (135), Expect = 6e-06 Identities = 31/99 (31%), Positives = 54/99 (54%), Gaps = 4/99 (4%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R KW GFE N+ Y+ ILR+ ++ ++EFW + EMK G+ ID +TY + Sbjct: 111 RFLKWAVEKNGFEPNSSIYSSILRIYANKDFLKEFWVTIKEMKEKGYYIDEETYKTIFST 170 Query: 160 FQKNKMLRDAVEL---YEHMM-DSPFKPSVKECTMLLRT 56 F+ KM +A L YE ++ ++ + VK+ ++++ Sbjct: 171 FRGLKMENEATALRHFYERLIKENTIEDKVKQVVDVVKS 209 >gb|EYU22186.1| hypothetical protein MIMGU_mgv1a005737mg [Erythranthe guttata] Length = 472 Score = 175 bits (444), Expect = 9e-42 Identities = 83/111 (74%), Positives = 91/111 (81%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ SL F+HN VTYNGILRVLCWE+SI EFW ++ EMK AGFE+D+DTYIKV RQ Q Sbjct: 101 FKWVERSLNFKHNGVTYNGILRVLCWEDSISEFWFVMDEMKGAGFELDIDTYIKVSRQLQ 160 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 KNKML DAV LYEHMMDS FKPS EC LLRTI+T PDLDLVFRVVNK Sbjct: 161 KNKMLGDAVNLYEHMMDSSFKPSFTECNSLLRTIATYTTPDLDLVFRVVNK 211 >ref|XP_009782591.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana sylvestris] Length = 642 Score = 173 bits (438), Expect = 5e-41 Identities = 82/111 (73%), Positives = 94/111 (84%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ SLGF+HN VTYNGILRVLC EESI+EFWS+V EMKS GFEIDLDTYIK+ R FQ Sbjct: 254 FKWVARSLGFQHNTVTYNGILRVLCREESIEEFWSVVEEMKSVGFEIDLDTYIKISRHFQ 313 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K +MLRDAVELYE MMD FKPS+ EC +LLR+I+ +PPDLDL+FRVV K Sbjct: 314 KIRMLRDAVELYELMMDGQFKPSLGECNILLRSIAQSNPPDLDLLFRVVGK 364 >ref|XP_009587009.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Nicotiana tomentosiformis] Length = 642 Score = 172 bits (437), Expect = 6e-41 Identities = 82/111 (73%), Positives = 94/111 (84%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ SLGF+HN VTYNGILRVLC EESI+EFWS+V EMKS GFEIDLDTYIK+ R FQ Sbjct: 254 FKWVARSLGFQHNTVTYNGILRVLCREESIEEFWSVVEEMKSIGFEIDLDTYIKISRHFQ 313 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K +MLRDAVELYE MMD FKPS+ EC +LLR+I+ +PPDLDL+FRVV K Sbjct: 314 KIRMLRDAVELYELMMDGQFKPSLGECNILLRSIAQSNPPDLDLLFRVVGK 364 >emb|CDP12719.1| unnamed protein product [Coffea canephora] Length = 637 Score = 166 bits (419), Expect = 7e-39 Identities = 74/111 (66%), Positives = 93/111 (83%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+G SLG+EH +VTYNG+LR+LC E + EFWS+V EMK AG+EID+DTY+KV+R+FQ Sbjct: 258 FKWVGESLGYEHTSVTYNGMLRILCKGEVVTEFWSMVKEMKDAGYEIDIDTYVKVMREFQ 317 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K+ M++DAVELYEHMMDSPFKP KEC++LLR I+ PDLDL+ RVV K Sbjct: 318 KSMMVKDAVELYEHMMDSPFKPLEKECSLLLRAIAHAQDPDLDLMLRVVKK 368 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/79 (34%), Positives = 44/79 (55%), Gaps = 3/79 (3%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW GF + Y+ +LR+ +++EFW ++ EMK G+ ID +TY + F+ Sbjct: 119 FKWAIEEKGFRPSTSIYSLMLRIYAKNHAMKEFWVVIKEMKEKGYYIDEETYASIYSDFR 178 Query: 154 KNKMLRDAVEL---YEHMM 107 +K++ DA L YE M+ Sbjct: 179 NSKLVNDATALKHFYERMI 197 >ref|XP_006344474.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 642 Score = 162 bits (409), Expect = 1e-37 Identities = 76/111 (68%), Positives = 89/111 (80%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ +L F+H +TYNGILRVLC EESI+EFW +V EM S GFEIDLDTYIK+ R FQ Sbjct: 254 FKWVARNLDFQHTTITYNGILRVLCREESIEEFWGVVKEMMSLGFEIDLDTYIKISRHFQ 313 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K KML+DAVELYE MMD FKPS+ EC +LLR+I+ HP DLDL+FRVV K Sbjct: 314 KIKMLKDAVELYELMMDGQFKPSLGECNILLRSIAQSHPSDLDLLFRVVEK 364 >ref|XP_004236267.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] gi|723687967|ref|XP_010319018.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] gi|723687970|ref|XP_010319019.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Solanum lycopersicum] Length = 642 Score = 157 bits (397), Expect = 3e-36 Identities = 75/111 (67%), Positives = 89/111 (80%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 FKW+ +L F+H+ VTYNGILRVLC EESI+EFW +V EM S GFEIDLDTYIK+ R FQ Sbjct: 254 FKWVARNLDFQHSTVTYNGILRVLCREESIEEFWGVVKEMMSLGFEIDLDTYIKISRHFQ 313 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K KML+DAVELYE MMD FKPS+ EC +LLR+I+ + DLDL+FRVV K Sbjct: 314 KIKMLKDAVELYELMMDGQFKPSLGECNILLRSIAQSYSSDLDLLFRVVEK 364 >ref|XP_010519534.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Tarenaya hassleriana] Length = 615 Score = 156 bits (394), Expect = 6e-36 Identities = 70/111 (63%), Positives = 87/111 (78%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F+W+GG ++HN +TYN ILRVL S+ EFWS++ EMK+AG E+DLDTYIKV RQFQ Sbjct: 245 FRWVGGFSSYDHNTITYNAILRVLARPNSVGEFWSVIDEMKTAGSEMDLDTYIKVSRQFQ 304 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K++M+ D V LYE MMD PFKPS +EC++LLR +STC PDLDLVFRV K Sbjct: 305 KSRMMVDVVRLYEFMMDGPFKPSAQECSLLLRALSTCPDPDLDLVFRVARK 355 >ref|XP_009362936.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Pyrus x bretschneideri] Length = 658 Score = 155 bits (393), Expect = 8e-36 Identities = 68/113 (60%), Positives = 88/113 (77%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R F W+G G+EHN +TYN + RVL W +SI EFWS++ EMK+AG E+DLDTYIK+ RQ Sbjct: 248 RFFHWVGQCSGYEHNTITYNAVARVLAWADSIGEFWSVIEEMKAAGHELDLDTYIKITRQ 307 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQK++M+ DAV+LYE MD P+KPS ++C+MLLR+IS PDLD+VFRV K Sbjct: 308 FQKSRMMEDAVKLYELTMDGPYKPSTQDCSMLLRSISGSDKPDLDMVFRVAKK 360 >ref|XP_008239337.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Prunus mume] Length = 630 Score = 154 bits (390), Expect = 2e-35 Identities = 68/111 (61%), Positives = 88/111 (79%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F W+G S G+EHN +TYN + R++ +SI EFWS++ EMK AG E+DLDTYIK+ RQFQ Sbjct: 253 FHWLGQSSGYEHNTITYNAVARIIAQADSIGEFWSVIEEMKGAGHELDLDTYIKITRQFQ 312 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K+KM+ DAV+LYE MMD P+KPSV++C+MLLR+IS PDLD+VFRV K Sbjct: 313 KSKMMEDAVKLYELMMDGPYKPSVQDCSMLLRSISASDKPDLDMVFRVAKK 363 >ref|XP_008392892.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Malus domestica] Length = 658 Score = 154 bits (388), Expect = 3e-35 Identities = 67/113 (59%), Positives = 87/113 (76%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R F W+G G+EHN +TYN + RVL W +S+ FWS++ EMK+AG E+DLDTYIK+ RQ Sbjct: 248 RFFHWVGQCSGYEHNTITYNAVARVLAWADSMGXFWSVIEEMKAAGHELDLDTYIKITRQ 307 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQK++M+ DAV+LYE MMD P+KPS ++C MLLR+IS PDLD+VFRV K Sbjct: 308 FQKSRMMEDAVKLYELMMDGPYKPSAQDCIMLLRSISGSDKPDLDMVFRVAKK 360 >ref|XP_007210500.1| hypothetical protein PRUPE_ppa002676mg [Prunus persica] gi|462406235|gb|EMJ11699.1| hypothetical protein PRUPE_ppa002676mg [Prunus persica] Length = 646 Score = 153 bits (387), Expect = 4e-35 Identities = 68/111 (61%), Positives = 87/111 (78%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F W+G S G+EHN +TYN + R+L +SI EFWS++ EMK AG E+DLDTYIK+ RQFQ Sbjct: 269 FHWVGQSSGYEHNTITYNAVARILAQADSIGEFWSVIEEMKGAGHELDLDTYIKITRQFQ 328 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K+KM+ DAV+LYE MMD P+KPS ++C+MLLR+IS PDLD+VFRV K Sbjct: 329 KSKMMEDAVKLYELMMDGPYKPSAQDCSMLLRSISANDKPDLDMVFRVAKK 379 >gb|KDO69474.1| hypothetical protein CISIN_1g037477mg [Citrus sinensis] Length = 639 Score = 153 bits (386), Expect = 5e-35 Identities = 66/111 (59%), Positives = 92/111 (82%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F+W+G G++HN +TYNGILRVL ES+++FW++V EMK G+E+D+DTYIK+ RQFQ Sbjct: 253 FRWVGEHSGYKHNTITYNGILRVLARHESVRDFWNVVEEMKKEGYEMDIDTYIKISRQFQ 312 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K +M+ DAV+L+E MMD P+KPSV++C++LLR+IS+ + PDL LVFRV NK Sbjct: 313 KFRMMEDAVKLFEFMMDGPYKPSVQDCSLLLRSISSINNPDLGLVFRVANK 363 >ref|XP_006476892.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Citrus sinensis] Length = 639 Score = 153 bits (386), Expect = 5e-35 Identities = 66/111 (59%), Positives = 92/111 (82%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F+W+G G++HN +TYNGILRVL ES+++FW++V EMK G+E+D+DTYIK+ RQFQ Sbjct: 253 FRWVGEHSGYKHNTITYNGILRVLARHESVRDFWNVVEEMKKEGYEMDIDTYIKISRQFQ 312 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K +M+ DAV+L+E MMD P+KPSV++C++LLR+IS+ + PDL LVFRV NK Sbjct: 313 KFRMMEDAVKLFEFMMDGPYKPSVQDCSLLLRSISSINNPDLGLVFRVANK 363 >ref|XP_002277390.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic [Vitis vinifera] Length = 631 Score = 152 bits (385), Expect = 6e-35 Identities = 73/113 (64%), Positives = 90/113 (79%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R F+W+G G+EH+++TYN I RVL ++SI EFWS+V EMKS G E+D+DTYIK+ RQ Sbjct: 250 RFFQWVGECPGYEHSSITYNVIARVLGRDDSIGEFWSMVEEMKSKGHEMDIDTYIKISRQ 309 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQKNKML DAV+LYE MMD P+KPSV++CTMLLR+IS PDL LVFRV K Sbjct: 310 FQKNKMLEDAVKLYEIMMDGPYKPSVQDCTMLLRSISLSSNPDLALVFRVTEK 362 Score = 60.5 bits (145), Expect = 4e-07 Identities = 35/97 (36%), Positives = 51/97 (52%), Gaps = 8/97 (8%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F W+ GF ++ Y+ ILR L ES+++FW + +MK GF ID +TY+ +L F+ Sbjct: 115 FNWVTEKNGFRPSSAMYSLILRSLVHGESMKQFWVTIRKMKEQGFCIDKETYLTILGVFK 174 Query: 154 KNKMLRDAVEL--------YEHMMDSPFKPSVKECTM 68 K KM + V L E+ MD K V+ TM Sbjct: 175 KGKMASEEVALTHFYNRMVQENAMDEVVKKVVELVTM 211 >gb|EPS62186.1| hypothetical protein M569_12607 [Genlisea aurea] Length = 627 Score = 152 bits (385), Expect = 6e-35 Identities = 69/113 (61%), Positives = 84/113 (74%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R FKWI S FEH VTYNG+LR+LC EESI EFW++ +EM +AGF +D+DTY+KV R Sbjct: 254 RFFKWIESSSDFEHTTVTYNGVLRILCREESIDEFWNVFSEMNAAGFRLDIDTYVKVSRS 313 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQKN M D V+LYEHMMDSP+KPSV EC LL+ +S PDL L+ RV+ K Sbjct: 314 FQKNAMFEDGVKLYEHMMDSPYKPSVSECNYLLQALSRHGSPDLGLIDRVIEK 366 >ref|XP_006439927.1| hypothetical protein CICLE_v10019266mg [Citrus clementina] gi|557542189|gb|ESR53167.1| hypothetical protein CICLE_v10019266mg [Citrus clementina] Length = 639 Score = 151 bits (382), Expect = 1e-34 Identities = 65/111 (58%), Positives = 92/111 (82%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F+W+G G++HN +TYNGILRVL ES+++FW++V EMK G+E+D+DTYIK+ RQFQ Sbjct: 253 FRWVGEHSGYKHNTITYNGILRVLARHESVRDFWNVVEEMKKEGYEMDIDTYIKISRQFQ 312 Query: 154 KNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 K +++ DAV+L+E MMD P+KPSV++C++LLR+IS+ + PDL LVFRV NK Sbjct: 313 KFRIMEDAVKLFEFMMDGPYKPSVQDCSLLLRSISSINNPDLGLVFRVANK 363 >ref|XP_002511313.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550428|gb|EEF51915.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 627 Score = 149 bits (377), Expect = 5e-34 Identities = 71/113 (62%), Positives = 90/113 (79%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 + F W G +E N +TYN I RVL ++SI EFWS+V EMK+AG E+D+DTYIK+ RQ Sbjct: 248 QFFNWAGKCERYECNTITYNAIARVLGRDDSIGEFWSVVEEMKNAGHEMDIDTYIKISRQ 307 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQKNK++ DAV+LYE MMD PFKPSV++C+MLLR+IS + PDL+LVFRVVNK Sbjct: 308 FQKNKLMGDAVKLYEFMMDGPFKPSVQDCSMLLRSISASNYPDLNLVFRVVNK 360 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/77 (35%), Positives = 47/77 (61%) Frame = -1 Query: 334 FKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQFQ 155 F W+ GF+ ++ Y+ +LR+L ++S++ FW + +MK GF D +TY+ +L F+ Sbjct: 113 FNWVCDRNGFKPSSPLYSLMLRILVKKDSMKNFWITLRKMKEQGFYTDEETYLTILGVFR 172 Query: 154 KNKMLRDAVELYEHMMD 104 K +M DAV ++H D Sbjct: 173 KERMDSDAV-AFKHFFD 188 >ref|XP_008380527.1| PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Malus domestica] Length = 634 Score = 149 bits (376), Expect = 7e-34 Identities = 67/113 (59%), Positives = 86/113 (76%) Frame = -1 Query: 340 RIFKWIGGSLGFEHNAVTYNGILRVLCWEESIQEFWSIVTEMKSAGFEIDLDTYIKVLRQ 161 R F+W G G+EHN +TYN + RVL +SI EFWS++ MK AG E+DLDTYIK+ RQ Sbjct: 252 RFFRWAGQCSGYEHNTITYNAVARVLARADSIGEFWSVIEGMKGAGHELDLDTYIKITRQ 311 Query: 160 FQKNKMLRDAVELYEHMMDSPFKPSVKECTMLLRTISTCHPPDLDLVFRVVNK 2 FQK++M+ DAV+LYE MMD P+KPS ++C+MLLR+IS PDLD+VFRV K Sbjct: 312 FQKSRMIEDAVKLYELMMDGPYKPSAQDCSMLLRSISGSDKPDLDMVFRVAKK 364