BLASTX nr result
ID: Forsythia21_contig00033229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033229 (217 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849033.1| PREDICTED: inositol transporter 4-like [Eryt... 59 2e-06 ref|XP_011095946.1| PREDICTED: inositol transporter 4-like [Sesa... 57 4e-06 ref|XP_011086243.1| PREDICTED: inositol transporter 4 [Sesamum i... 56 8e-06 >ref|XP_012849033.1| PREDICTED: inositol transporter 4-like [Erythranthe guttatus] gi|604314977|gb|EYU27683.1| hypothetical protein MIMGU_mgv1a003465mg [Erythranthe guttata] gi|604314978|gb|EYU27684.1| hypothetical protein MIMGU_mgv1a003465mg [Erythranthe guttata] Length = 583 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 33/39 (84%), Gaps = 1/39 (2%) Frame = +2 Query: 2 FLVPETKRLQFEEVEKMLEKGFKPNICC-SNKPAAEEED 115 F+VPETK LQFEEVEKMLEKGF+P +CC SN ++ E+D Sbjct: 540 FVVPETKGLQFEEVEKMLEKGFRPRLCCGSNSSSSTEKD 578 >ref|XP_011095946.1| PREDICTED: inositol transporter 4-like [Sesamum indicum] Length = 577 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/37 (64%), Positives = 31/37 (83%) Frame = +2 Query: 2 FLVPETKRLQFEEVEKMLEKGFKPNICCSNKPAAEEE 112 FLVPETK L FE+VE+MLEKGFKP +CC +K + ++E Sbjct: 540 FLVPETKGLAFEDVERMLEKGFKPRLCCKSKDSNDDE 576 >ref|XP_011086243.1| PREDICTED: inositol transporter 4 [Sesamum indicum] Length = 576 Score = 56.2 bits (134), Expect = 8e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +2 Query: 2 FLVPETKRLQFEEVEKMLEKGFKPNICCS 88 F+VPETK LQFEEVEKMLEKGFKP +CC+ Sbjct: 540 FIVPETKGLQFEEVEKMLEKGFKPRMCCN 568