BLASTX nr result
ID: Forsythia21_contig00033083
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00033083 (391 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007924055.1| hypothetical protein MYCFIDRAFT_132457 [Pseu... 64 3e-08 gb|EMF07953.1| NIPSNAP-domain-containing protein [Sphaerulina mu... 62 1e-07 ref|XP_007781563.1| hypothetical protein W97_05639 [Coniosporium... 60 4e-07 ref|XP_007674648.1| hypothetical protein BAUCODRAFT_67128 [Baudo... 59 1e-06 gb|EME38733.1| hypothetical protein DOTSEDRAFT_75475 [Dothistrom... 58 2e-06 ref|XP_003838500.1| hypothetical protein LEMA_P114360.1 [Leptosp... 57 4e-06 gb|KJX98248.1| nipsnap family protein [Zymoseptoria brevis] 57 6e-06 ref|XP_003847759.1| hypothetical protein MYCGRDRAFT_97379 [Zymos... 57 6e-06 >ref|XP_007924055.1| hypothetical protein MYCFIDRAFT_132457 [Pseudocercospora fijiensis CIRAD86] gi|452987206|gb|EME86962.1| hypothetical protein MYCFIDRAFT_132457 [Pseudocercospora fijiensis CIRAD86] Length = 352 Score = 64.3 bits (155), Expect = 3e-08 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -3 Query: 128 ENDPKQKKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 E +KK+G+G LS LIYGTEEGR+MD++IERSFSQVLARG Sbjct: 96 EESENKKKIGTGRLSSLIYGTEEGREMDREIERSFSQVLARG 137 >gb|EMF07953.1| NIPSNAP-domain-containing protein [Sphaerulina musiva SO2202] Length = 396 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/42 (69%), Positives = 37/42 (88%) Frame = -3 Query: 128 ENDPKQKKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 + DP KK G+G LS++I+GTEEGR+MD++IERSFSQVLARG Sbjct: 140 QQDPDGKKKGTGLLSRVIHGTEEGREMDREIERSFSQVLARG 181 >ref|XP_007781563.1| hypothetical protein W97_05639 [Coniosporium apollinis CBS 100218] gi|494829658|gb|EON66246.1| hypothetical protein W97_05639 [Coniosporium apollinis CBS 100218] Length = 331 Score = 60.5 bits (145), Expect = 4e-07 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -3 Query: 95 GPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 GPL+KLIYGT+EGR+MDQDIERSFSQVLARG Sbjct: 86 GPLNKLIYGTKEGRQMDQDIERSFSQVLARG 116 >ref|XP_007674648.1| hypothetical protein BAUCODRAFT_67128 [Baudoinia compniacensis UAMH 10762] gi|449302524|gb|EMC98533.1| hypothetical protein BAUCODRAFT_67128 [Baudoinia compniacensis UAMH 10762] Length = 375 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 122 DPKQKKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 D +KK SG LS IYGTEEGR+MD++IERSFSQVLARG Sbjct: 121 DHGKKKAPSGGLSSFIYGTEEGREMDREIERSFSQVLARG 160 >gb|EME38733.1| hypothetical protein DOTSEDRAFT_75475 [Dothistroma septosporum NZE10] Length = 376 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -3 Query: 128 ENDPKQKKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 E D K +G LS LIYGTEEGR+MD++IERSFSQVLARG Sbjct: 120 EQDADGNKKKTGRLSSLIYGTEEGREMDREIERSFSQVLARG 161 >ref|XP_003838500.1| hypothetical protein LEMA_P114360.1 [Leptosphaeria maculans JN3] gi|312215068|emb|CBX95021.1| hypothetical protein LEMA_P114360.1 [Leptosphaeria maculans JN3] Length = 419 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -3 Query: 128 ENDPKQKKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 E++ QKK SG LS LIYGT EGR++D+DIERSFSQVLARG Sbjct: 165 EHESGQKK--SGKLSSLIYGTPEGRELDKDIERSFSQVLARG 204 >gb|KJX98248.1| nipsnap family protein [Zymoseptoria brevis] Length = 393 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 110 KKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 KK G+G S LI+GTEEGR+MD++IERSFSQVLARG Sbjct: 143 KKKGTGLFSSLIHGTEEGREMDREIERSFSQVLARG 178 >ref|XP_003847759.1| hypothetical protein MYCGRDRAFT_97379 [Zymoseptoria tritici IPO323] gi|339467632|gb|EGP82735.1| hypothetical protein MYCGRDRAFT_97379 [Zymoseptoria tritici IPO323] Length = 397 Score = 56.6 bits (135), Expect = 6e-06 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 110 KKVGSGPLSKLIYGTEEGRKMDQDIERSFSQVLARG 3 KK G+G S LI+GTEEGR+MD++IERSFSQVLARG Sbjct: 147 KKKGTGLFSSLIHGTEEGREMDREIERSFSQVLARG 182