BLASTX nr result
ID: Forsythia21_contig00032896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032896 (267 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KER00273.1| hypothetical protein AUEXF2481DRAFT_24620 [Aureob... 70 6e-10 gb|KEQ88067.1| hypothetical protein M438DRAFT_291210 [Aureobasid... 70 6e-10 gb|KEQ70183.1| hypothetical protein M436DRAFT_75503 [Aureobasidi... 70 6e-10 gb|KEQ62919.1| outer mitochondrial membrane porin protein [Aureo... 70 6e-10 dbj|GAM84278.1| hypothetical protein ANO11243_022720 [fungal sp.... 69 1e-09 gb|KJX94834.1| hypothetical protein TI39_contig4156g00009 [Zymos... 68 2e-09 gb|EME44434.1| hypothetical protein DOTSEDRAFT_72045 [Dothistrom... 68 2e-09 ref|XP_003847948.1| hypothetical protein MYCGRDRAFT_77435 [Zymos... 68 2e-09 ref|XP_007924886.1| hypothetical protein MYCFIDRAFT_214674 [Pseu... 68 3e-09 ref|XP_007675502.1| hypothetical protein BAUCODRAFT_69206 [Baudo... 68 3e-09 gb|KIW05144.1| hypothetical protein PV09_03695 [Verruconis gallo... 66 1e-08 ref|XP_007582417.1| putative outer mitochondrial membrane protei... 65 1e-08 gb|EKG21412.1| Porin eukaryotic type [Macrophomina phaseolina MS6] 65 1e-08 ref|XP_003835324.1| similar to Mitochondrial porin (voltage-depe... 64 4e-08 gb|KKY27380.1| putative outer mitochondrial membrane protein por... 63 7e-08 ref|XP_008026603.1| hypothetical protein SETTUDRAFT_169595 [Seto... 63 7e-08 gb|EMD97813.1| hypothetical protein COCHEDRAFT_1125725 [Bipolari... 63 7e-08 ref|XP_007683450.1| hypothetical protein COCMIDRAFT_83011 [Bipol... 63 7e-08 ref|XP_003295494.1| hypothetical protein PTT_01274 [Pyrenophora ... 63 7e-08 ref|XP_001934706.1| outer mitochondrial membrane protein porin 1... 63 7e-08 >gb|KER00273.1| hypothetical protein AUEXF2481DRAFT_24620 [Aureobasidium subglaciale EXF-2481] Length = 360 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTKLN GTTFGVGLSLDT KLNEAGHKIGTS FEG Sbjct: 324 YNTKLNAGTTFGVGLSLDTNKLNEAGHKIGTSFVFEG 360 >gb|KEQ88067.1| hypothetical protein M438DRAFT_291210 [Aureobasidium pullulans EXF-150] Length = 367 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTKLN GTTFGVGLSLDT KLNEAGHKIGTS FEG Sbjct: 331 YNTKLNAGTTFGVGLSLDTNKLNEAGHKIGTSFVFEG 367 >gb|KEQ70183.1| hypothetical protein M436DRAFT_75503 [Aureobasidium namibiae CBS 147.97] Length = 368 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTKLN GTTFGVGLSLDT KLNEAGHKIGTS FEG Sbjct: 332 YNTKLNAGTTFGVGLSLDTNKLNEAGHKIGTSFVFEG 368 >gb|KEQ62919.1| outer mitochondrial membrane porin protein [Aureobasidium melanogenum CBS 110374] Length = 292 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTKLN GTTFGVGLSLDT KLNEAGHKIGTS FEG Sbjct: 256 YNTKLNAGTTFGVGLSLDTNKLNEAGHKIGTSFVFEG 292 >dbj|GAM84278.1| hypothetical protein ANO11243_022720 [fungal sp. No.11243] Length = 307 Score = 68.9 bits (167), Expect = 1e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N GTT G+GLSLDT KLNEAGHKIGTSLTFEG Sbjct: 271 YNTKVNSGTTLGLGLSLDTNKLNEAGHKIGTSLTFEG 307 >gb|KJX94834.1| hypothetical protein TI39_contig4156g00009 [Zymoseptoria brevis] Length = 374 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 Y+TKLN GTT G+GLSLDT KLNEAGHKIGTSLTFEG Sbjct: 338 YSTKLNAGTTLGLGLSLDTNKLNEAGHKIGTSLTFEG 374 >gb|EME44434.1| hypothetical protein DOTSEDRAFT_72045 [Dothistroma septosporum NZE10] Length = 306 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 Y+TKLN GTT G+GLSLDT KLNEAGHKIGTSLTFEG Sbjct: 270 YSTKLNAGTTIGLGLSLDTNKLNEAGHKIGTSLTFEG 306 >ref|XP_003847948.1| hypothetical protein MYCGRDRAFT_77435 [Zymoseptoria tritici IPO323] gi|339467822|gb|EGP82924.1| hypothetical protein MYCGRDRAFT_77435 [Zymoseptoria tritici IPO323] Length = 303 Score = 68.2 bits (165), Expect = 2e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 Y+TKLN GTT G+GLSLDT KLNEAGHKIGTSLTFEG Sbjct: 267 YSTKLNAGTTLGLGLSLDTNKLNEAGHKIGTSLTFEG 303 >ref|XP_007924886.1| hypothetical protein MYCFIDRAFT_214674 [Pseudocercospora fijiensis CIRAD86] gi|452984505|gb|EME84262.1| hypothetical protein MYCFIDRAFT_214674 [Pseudocercospora fijiensis CIRAD86] Length = 371 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 Y+TKLN GTT G+GLSLDT KLNEAGHKIGTSLTFEG Sbjct: 335 YSTKLNPGTTLGLGLSLDTNKLNEAGHKIGTSLTFEG 371 >ref|XP_007675502.1| hypothetical protein BAUCODRAFT_69206 [Baudoinia compniacensis UAMH 10762] gi|449301608|gb|EMC97619.1| hypothetical protein BAUCODRAFT_69206 [Baudoinia compniacensis UAMH 10762] Length = 287 Score = 67.8 bits (164), Expect = 3e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 Y+TKLN GTT G+G+SLDT KLNEAGHKIGTSLTFEG Sbjct: 251 YSTKLNTGTTIGLGISLDTQKLNEAGHKIGTSLTFEG 287 >gb|KIW05144.1| hypothetical protein PV09_03695 [Verruconis gallopava] Length = 285 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N+G TFG+G+SLDT KLNEA HKIGTS TFEG Sbjct: 249 YNTKINQGFTFGIGVSLDTQKLNEASHKIGTSFTFEG 285 >ref|XP_007582417.1| putative outer mitochondrial membrane protein porin protein [Neofusicoccum parvum UCRNP2] gi|485925562|gb|EOD50101.1| putative outer mitochondrial membrane protein porin protein [Neofusicoccum parvum UCRNP2] Length = 333 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N+G TFG+G SLDT KLNEAGHKIG S TFEG Sbjct: 297 YNTKINQGFTFGIGASLDTQKLNEAGHKIGASFTFEG 333 >gb|EKG21412.1| Porin eukaryotic type [Macrophomina phaseolina MS6] Length = 284 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N+G TFG+G SLDT KLNEAGHKIG S TFEG Sbjct: 248 YNTKINQGFTFGIGASLDTQKLNEAGHKIGASFTFEG 284 >ref|XP_003835324.1| similar to Mitochondrial porin (voltage-dependent anion channel) [Leptosphaeria maculans JN3] gi|312211875|emb|CBX91959.1| similar to Mitochondrial porin (voltage-dependent anion channel) [Leptosphaeria maculans JN3] Length = 297 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHKIGTS TFEG Sbjct: 261 YNTKVNSGLTFGIGGSFDTQKLNEAGHKIGTSFTFEG 297 >gb|KKY27380.1| putative outer mitochondrial membrane protein porin [Diplodia seriata] Length = 284 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N+G TFG+G SLD KLNEAGHK+G S TFEG Sbjct: 248 YNTKINQGFTFGIGASLDAQKLNEAGHKVGASFTFEG 284 >ref|XP_008026603.1| hypothetical protein SETTUDRAFT_169595 [Setosphaeria turcica Et28A] gi|482808956|gb|EOA85817.1| hypothetical protein SETTUDRAFT_169595 [Setosphaeria turcica Et28A] Length = 297 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHK+GTS TFEG Sbjct: 261 YNTKVNSGLTFGIGGSFDTQKLNEAGHKLGTSFTFEG 297 >gb|EMD97813.1| hypothetical protein COCHEDRAFT_1125725 [Bipolaris maydis C5] gi|477585704|gb|ENI02791.1| hypothetical protein COCC4DRAFT_200867 [Bipolaris maydis ATCC 48331] Length = 297 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHK+GTS TFEG Sbjct: 261 YNTKVNSGLTFGIGGSFDTQKLNEAGHKLGTSFTFEG 297 >ref|XP_007683450.1| hypothetical protein COCMIDRAFT_83011 [Bipolaris oryzae ATCC 44560] gi|628084556|ref|XP_007704128.1| hypothetical protein COCSADRAFT_40587 [Bipolaris sorokiniana ND90Pr] gi|628212775|ref|XP_007713533.1| hypothetical protein COCCADRAFT_99332 [Bipolaris zeicola 26-R-13] gi|451846845|gb|EMD60154.1| hypothetical protein COCSADRAFT_40587 [Bipolaris sorokiniana ND90Pr] gi|576917968|gb|EUC32176.1| hypothetical protein COCCADRAFT_99332 [Bipolaris zeicola 26-R-13] gi|576936565|gb|EUC50059.1| hypothetical protein COCMIDRAFT_83011 [Bipolaris oryzae ATCC 44560] gi|578489989|gb|EUN27409.1| hypothetical protein COCVIDRAFT_98325 [Bipolaris victoriae FI3] Length = 297 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHK+GTS TFEG Sbjct: 261 YNTKVNSGLTFGIGGSFDTQKLNEAGHKLGTSFTFEG 297 >ref|XP_003295494.1| hypothetical protein PTT_01274 [Pyrenophora teres f. teres 0-1] gi|311333188|gb|EFQ96412.1| hypothetical protein PTT_01274 [Pyrenophora teres f. teres 0-1] Length = 297 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHK+GTS TFEG Sbjct: 261 YNTKVNSGLTFGIGGSFDTQKLNEAGHKLGTSFTFEG 297 >ref|XP_001934706.1| outer mitochondrial membrane protein porin 1 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|187980585|gb|EDU47211.1| outer mitochondrial membrane protein porin 1 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 282 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 267 YNTKLNRGTTFGVGLSLDTAKLNEAGHKIGTSLTFEG 157 YNTK+N G TFG+G S DT KLNEAGHK+GTS TFEG Sbjct: 246 YNTKVNSGLTFGIGGSFDTQKLNEAGHKLGTSFTFEG 282