BLASTX nr result
ID: Forsythia21_contig00032793
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032793 (232 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO78959.1| hypothetical protein CISIN_1g017630mg [Citrus sin... 83 6e-14 ref|XP_006426072.1| hypothetical protein CICLE_v10025991mg [Citr... 83 6e-14 ref|XP_012856453.1| PREDICTED: UPF0553 protein-like [Erythranthe... 83 8e-14 ref|XP_006466479.1| PREDICTED: UPF0553 protein-like [Citrus sine... 82 1e-13 ref|XP_011099359.1| PREDICTED: UPF0553 protein-like isoform X2 [... 82 2e-13 ref|XP_011099356.1| PREDICTED: UPF0553 protein-like isoform X1 [... 82 2e-13 ref|XP_009379317.1| PREDICTED: UPF0553 protein-like [Pyrus x bre... 80 4e-13 ref|XP_008361433.1| PREDICTED: UPF0553 protein-like [Malus domes... 80 4e-13 ref|XP_008238106.1| PREDICTED: UPF0553 protein-like [Prunus mume] 80 4e-13 ref|XP_007205624.1| hypothetical protein PRUPE_ppa009128mg [Prun... 80 4e-13 ref|XP_004231913.1| PREDICTED: UPF0553 protein-like [Solanum lyc... 80 7e-13 ref|XP_007047491.1| Uncharacterized protein TCM_000771 [Theobrom... 79 9e-13 ref|XP_012456659.1| PREDICTED: UPF0553 protein-like isoform X1 [... 79 1e-12 gb|KHG12020.1| hypothetical protein F383_07123 [Gossypium arbore... 79 1e-12 ref|XP_008340973.1| PREDICTED: UPF0553 protein-like [Malus domes... 79 1e-12 ref|XP_011657891.1| PREDICTED: UPF0553 protein-like [Cucumis sat... 79 2e-12 emb|CDP02588.1| unnamed protein product [Coffea canephora] 79 2e-12 ref|XP_006339813.1| PREDICTED: UPF0553 protein-like [Solanum tub... 79 2e-12 ref|XP_010679618.1| PREDICTED: UPF0553 protein-like isoform X3 [... 77 3e-12 ref|XP_010679617.1| PREDICTED: UPF0553 protein-like isoform X2 [... 77 3e-12 >gb|KDO78959.1| hypothetical protein CISIN_1g017630mg [Citrus sinensis] Length = 368 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++RELI KSGKQVLSVELDLWLWSVG+Q PALQHHRTLSIYY Sbjct: 324 VEKMRELIRIKSGKQVLSVELDLWLWSVGVQCPALQHHRTLSIYY 368 >ref|XP_006426072.1| hypothetical protein CICLE_v10025991mg [Citrus clementina] gi|557528062|gb|ESR39312.1| hypothetical protein CICLE_v10025991mg [Citrus clementina] Length = 344 Score = 83.2 bits (204), Expect = 6e-14 Identities = 39/45 (86%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++RELI KSGKQVLSVELDLWLWSVG+Q PALQHHRTLSIYY Sbjct: 300 VEKMRELIRIKSGKQVLSVELDLWLWSVGVQCPALQHHRTLSIYY 344 >ref|XP_012856453.1| PREDICTED: UPF0553 protein-like [Erythranthe guttatus] Length = 306 Score = 82.8 bits (203), Expect = 8e-14 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VEEIRE IHRK+G QVLSVELDLWLW+ G+Q P+LQHHRTLSIYY Sbjct: 262 VEEIRETIHRKTGNQVLSVELDLWLWAFGVQCPSLQHHRTLSIYY 306 >ref|XP_006466479.1| PREDICTED: UPF0553 protein-like [Citrus sinensis] Length = 306 Score = 82.0 bits (201), Expect = 1e-13 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGKQVLSVELDLWLWSVG+Q PALQHHRTLSIYY Sbjct: 262 VEKMKELIRIKSGKQVLSVELDLWLWSVGVQCPALQHHRTLSIYY 306 >ref|XP_011099359.1| PREDICTED: UPF0553 protein-like isoform X2 [Sesamum indicum] Length = 258 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VEEIRELI RKSGKQVLSVELDLWLW+ G+Q +LQHHRTLSIYY Sbjct: 214 VEEIRELIRRKSGKQVLSVELDLWLWAFGVQCASLQHHRTLSIYY 258 >ref|XP_011099356.1| PREDICTED: UPF0553 protein-like isoform X1 [Sesamum indicum] gi|747102386|ref|XP_011099357.1| PREDICTED: UPF0553 protein-like isoform X1 [Sesamum indicum] gi|747102388|ref|XP_011099358.1| PREDICTED: UPF0553 protein-like isoform X1 [Sesamum indicum] Length = 306 Score = 81.6 bits (200), Expect = 2e-13 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VEEIRELI RKSGKQVLSVELDLWLW+ G+Q +LQHHRTLSIYY Sbjct: 262 VEEIRELIRRKSGKQVLSVELDLWLWAFGVQCASLQHHRTLSIYY 306 >ref|XP_009379317.1| PREDICTED: UPF0553 protein-like [Pyrus x bretschneideri] Length = 305 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGKQVLS+ELDLWLWS GIQ PALQHHRTLSIYY Sbjct: 261 VEKMKELISMKSGKQVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_008361433.1| PREDICTED: UPF0553 protein-like [Malus domestica] Length = 305 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGKQVLS+ELDLWLWS GIQ PALQHHRTLSIYY Sbjct: 261 VEKMKELISMKSGKQVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_008238106.1| PREDICTED: UPF0553 protein-like [Prunus mume] Length = 305 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGKQVLS+ELDLWLWS GIQ PALQHHRTLSIYY Sbjct: 261 VEKMKELISMKSGKQVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_007205624.1| hypothetical protein PRUPE_ppa009128mg [Prunus persica] gi|462401266|gb|EMJ06823.1| hypothetical protein PRUPE_ppa009128mg [Prunus persica] Length = 305 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGKQVLS+ELDLWLWS GIQ PALQHHRTLSIYY Sbjct: 261 VEKMKELISMKSGKQVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_004231913.1| PREDICTED: UPF0553 protein-like [Solanum lycopersicum] Length = 306 Score = 79.7 bits (195), Expect = 7e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+I+ELI +K+GKQVLSVELDLWLW+ GIQ P+LQHHRTLSIYY Sbjct: 262 VEKIKELISKKTGKQVLSVELDLWLWAFGIQCPSLQHHRTLSIYY 306 >ref|XP_007047491.1| Uncharacterized protein TCM_000771 [Theobroma cacao] gi|508699752|gb|EOX91648.1| Uncharacterized protein TCM_000771 [Theobroma cacao] Length = 306 Score = 79.3 bits (194), Expect = 9e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+IREL+ +KSGKQVLSVELDLWLWSVG++ +LQHHRTLSIYY Sbjct: 262 VEKIRELLSKKSGKQVLSVELDLWLWSVGVKRQSLQHHRTLSIYY 306 >ref|XP_012456659.1| PREDICTED: UPF0553 protein-like isoform X1 [Gossypium raimondii] gi|823247976|ref|XP_012456660.1| PREDICTED: UPF0553 protein-like isoform X1 [Gossypium raimondii] gi|763804204|gb|KJB71142.1| hypothetical protein B456_011G107900 [Gossypium raimondii] Length = 306 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++REL+ K GKQVLSVELDLWLWSVG+Q P+LQHHRTLSIYY Sbjct: 262 VEKMRELLSIKCGKQVLSVELDLWLWSVGVQCPSLQHHRTLSIYY 306 >gb|KHG12020.1| hypothetical protein F383_07123 [Gossypium arboreum] gi|728833191|gb|KHG12634.1| hypothetical protein F383_00980 [Gossypium arboreum] Length = 306 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++REL+ K GKQVLSVELDLWLWSVG+Q P+LQHHRTLSIYY Sbjct: 262 VEKMRELLSIKCGKQVLSVELDLWLWSVGVQCPSLQHHRTLSIYY 306 >ref|XP_008340973.1| PREDICTED: UPF0553 protein-like [Malus domestica] Length = 305 Score = 79.0 bits (193), Expect = 1e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI KSGK+VLS+ELDLWLWS GIQ PALQHHRTLSIYY Sbjct: 261 VEKMKELISMKSGKKVLSIELDLWLWSFGIQCPALQHHRTLSIYY 305 >ref|XP_011657891.1| PREDICTED: UPF0553 protein-like [Cucumis sativus] gi|700193395|gb|KGN48599.1| hypothetical protein Csa_6G495040 [Cucumis sativus] Length = 305 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/45 (82%), Positives = 40/45 (88%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++RELI KSGKQVLSVELDLWLWS GIQ P+L HHRTLSIYY Sbjct: 261 VEKMRELISMKSGKQVLSVELDLWLWSFGIQCPSLTHHRTLSIYY 305 >emb|CDP02588.1| unnamed protein product [Coffea canephora] Length = 306 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/45 (80%), Positives = 41/45 (91%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++RELI +K GKQVLSVELDLWLWSVG + P+LQHHRTLSIYY Sbjct: 262 VEKMRELISKKCGKQVLSVELDLWLWSVGTRCPSLQHHRTLSIYY 306 >ref|XP_006339813.1| PREDICTED: UPF0553 protein-like [Solanum tuberosum] Length = 306 Score = 78.6 bits (192), Expect = 2e-12 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE+++ELI +K+GKQVLSVELDLWLW+ GIQ P+LQHHRTLSIYY Sbjct: 262 VEKMKELISKKTGKQVLSVELDLWLWAFGIQCPSLQHHRTLSIYY 306 >ref|XP_010679618.1| PREDICTED: UPF0553 protein-like isoform X3 [Beta vulgaris subsp. vulgaris] Length = 258 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++R+LI KSGKQVLSVELDLWLWS GIQ P+L HHRTLSIYY Sbjct: 214 VEKMRDLIRLKSGKQVLSVELDLWLWSYGIQLPSLVHHRTLSIYY 258 >ref|XP_010679617.1| PREDICTED: UPF0553 protein-like isoform X2 [Beta vulgaris subsp. vulgaris] Length = 304 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = -3 Query: 230 VEEIRELIHRKSGKQVLSVELDLWLWSVGIQYPALQHHRTLSIYY 96 VE++R+LI KSGKQVLSVELDLWLWS GIQ P+L HHRTLSIYY Sbjct: 260 VEKMRDLIRLKSGKQVLSVELDLWLWSYGIQLPSLVHHRTLSIYY 304