BLASTX nr result
ID: Forsythia21_contig00032629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032629 (368 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081263.1| PREDICTED: pentatricopeptide repeat-containi... 91 3e-16 emb|CDP01475.1| unnamed protein product [Coffea canephora] 82 1e-13 ref|XP_011031040.1| PREDICTED: pentatricopeptide repeat-containi... 79 2e-12 ref|XP_002307076.2| pentatricopeptide repeat-containing family p... 77 4e-12 ref|XP_010087614.1| hypothetical protein L484_022141 [Morus nota... 73 6e-11 ref|XP_008346407.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 72 1e-10 ref|XP_012827302.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_008234126.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 ref|XP_007207635.1| hypothetical protein PRUPE_ppa021864mg [Prun... 70 7e-10 ref|XP_010669618.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_009791059.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_008459184.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|XP_008365867.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_009370728.1| PREDICTED: pentatricopeptide repeat-containi... 66 8e-09 ref|XP_012489272.1| PREDICTED: pentatricopeptide repeat-containi... 66 1e-08 ref|XP_004148109.1| PREDICTED: pentatricopeptide repeat-containi... 64 3e-08 ref|XP_010662158.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 emb|CBI26593.3| unnamed protein product [Vitis vinifera] 64 4e-08 ref|XP_007047919.1| Pentatricopeptide repeat (PPR) superfamily p... 64 4e-08 ref|XP_008382134.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 >ref|XP_011081263.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Sesamum indicum] gi|747068975|ref|XP_011081264.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Sesamum indicum] gi|747068977|ref|XP_011081265.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Sesamum indicum] gi|747068979|ref|XP_011081266.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Sesamum indicum] Length = 775 Score = 90.9 bits (224), Expect = 3e-16 Identities = 49/80 (61%), Positives = 57/80 (71%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDN 64 M +K YKRL+ S S D ++YL HI+SFLSNS LD +LL HAYIITTG++ N Sbjct: 1 MLVLKSLKFYKRLYCS-SVPDSEASYLTKHIDSFLSNSVLDSRTLLSTHAYIITTGHSHN 59 Query: 63 IFIASKLIAHYASLNQPHSS 4 FIASKLIA YAS NQPHSS Sbjct: 60 RFIASKLIASYASFNQPHSS 79 >emb|CDP01475.1| unnamed protein product [Coffea canephora] Length = 808 Score = 82.4 bits (202), Expect = 1e-13 Identities = 44/79 (55%), Positives = 57/79 (72%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDN 64 M + KF+ LY R +SS ST+ I SNYL+ INS LS+ LD SLL+ H+YIITTG +N Sbjct: 34 MPKFKFSSLYNRFYSS-STSGIVSNYLNCRINSLLSSQFLDLKSLLKFHSYIITTGQRNN 92 Query: 63 IFIASKLIAHYASLNQPHS 7 +FIASKL++ YA+LN S Sbjct: 93 LFIASKLMSIYAALNHLES 111 >ref|XP_011031040.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Populus euphratica] Length = 779 Score = 78.6 bits (192), Expect = 2e-12 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 2/75 (2%) Frame = -3 Query: 222 HLYKRLFSS-FSTA-DIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDNIFIAS 49 HL++RLF S F + +SNYL+ HI+SFLSN A SL + HA IITTGN +N+FI+S Sbjct: 9 HLFRRLFPSPFQISYHSSSNYLNCHIDSFLSNQAQTLQSLHKSHALIITTGNANNVFISS 68 Query: 48 KLIAHYASLNQPHSS 4 KLI+ YAS +PHSS Sbjct: 69 KLISLYASFRKPHSS 83 >ref|XP_002307076.2| pentatricopeptide repeat-containing family protein, partial [Populus trichocarpa] gi|550338333|gb|EEE94072.2| pentatricopeptide repeat-containing family protein, partial [Populus trichocarpa] Length = 744 Score = 77.0 bits (188), Expect = 4e-12 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 2/75 (2%) Frame = -3 Query: 222 HLYKRLFSS-FSTA-DIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDNIFIAS 49 HL++RLF S F + +SNYL+ HI+SFLSN SL + HA IITTGN +N+FI+S Sbjct: 10 HLFRRLFPSPFQISYHSSSNYLNCHIDSFLSNQTQTLQSLHKSHALIITTGNANNVFISS 69 Query: 48 KLIAHYASLNQPHSS 4 KLI+ YAS +PHSS Sbjct: 70 KLISLYASFRKPHSS 84 >ref|XP_010087614.1| hypothetical protein L484_022141 [Morus notabilis] gi|587838780|gb|EXB29469.1| hypothetical protein L484_022141 [Morus notabilis] Length = 778 Score = 73.2 bits (178), Expect = 6e-11 Identities = 39/82 (47%), Positives = 56/82 (68%), Gaps = 2/82 (2%) Frame = -3 Query: 243 MFRIKFTHLYKRL--FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNT 70 M +K T ++KR F F++ + NYL++ ++ FLS SLL+ HA IIT+GN+ Sbjct: 1 MLALKSTRVFKRFPSFLPFTSLSTSPNYLNDQLSLFLSAKTSTLQSLLKSHALIITSGNS 60 Query: 69 DNIFIASKLIAHYASLNQPHSS 4 +NIFIASKLI+ YASLN+P +S Sbjct: 61 NNIFIASKLISLYASLNRPTNS 82 >ref|XP_008346407.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like [Malus domestica] Length = 781 Score = 72.4 bits (176), Expect = 1e-10 Identities = 42/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (3%) Frame = -3 Query: 237 RIKFTHLYKRLFSSFS---TADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTD 67 R K HL+K L SS S ++ ASNY++ H++SFLSN F L Q HA IIT+ N++ Sbjct: 5 RHKSLHLFKHLPSSSSLPFSSLSASNYVNYHLDSFLSNQIPTFQHLSQSHALIITSANSN 64 Query: 66 NIFIASKLIAHYASLNQPHSS 4 NIFI +KLI+ YASL++P SS Sbjct: 65 NIFICAKLISLYASLSKPTSS 85 >ref|XP_012827302.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Erythranthe guttatus] Length = 753 Score = 70.1 bits (170), Expect = 5e-10 Identities = 42/86 (48%), Positives = 54/86 (62%), Gaps = 6/86 (6%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFST---ADIASNYLHNHINSFLSNS---ALDFNSLLQIHAYIIT 82 M KF L++R S+ + AD S+YL+ HI SFLSN+ +LL HAYIIT Sbjct: 1 MLAFKFPKLHRRRLRSYCSSIAADSESSYLNKHIESFLSNNNGFEESRTTLLSTHAYIIT 60 Query: 81 TGNTDNIFIASKLIAHYASLNQPHSS 4 TG+ N F+ASKLIA YA+LNQ S+ Sbjct: 61 TGHAHNRFLASKLIASYAALNQLDSA 86 >ref|XP_008234126.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Prunus mume] Length = 779 Score = 70.1 bits (170), Expect = 5e-10 Identities = 39/78 (50%), Positives = 54/78 (69%), Gaps = 1/78 (1%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFSTADI-ASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTD 67 M R K HL++R+ SS ASNYL+ ++SFLSN + L Q HA I+T+GN++ Sbjct: 3 MVRHKPIHLFRRVPSSLPFCSFSASNYLNCRLDSFLSNQNSNLQYLSQSHALIVTSGNSN 62 Query: 66 NIFIASKLIAHYASLNQP 13 NIFIA+KLI+ YASL++P Sbjct: 63 NIFIAAKLISLYASLSKP 80 >ref|XP_007207635.1| hypothetical protein PRUPE_ppa021864mg [Prunus persica] gi|462403277|gb|EMJ08834.1| hypothetical protein PRUPE_ppa021864mg [Prunus persica] Length = 748 Score = 69.7 bits (169), Expect = 7e-10 Identities = 39/78 (50%), Positives = 53/78 (67%), Gaps = 1/78 (1%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFSTADI-ASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTD 67 M R K +L+KR+ SS ASNYL+ ++SFLSN + L Q HA I+T+GN + Sbjct: 3 MLRHKPIYLFKRVPSSLPFCSFSASNYLNCQLHSFLSNQNSNLQYLSQSHALIVTSGNAN 62 Query: 66 NIFIASKLIAHYASLNQP 13 NIFIA+KLI+ YASL++P Sbjct: 63 NIFIAAKLISFYASLSKP 80 >ref|XP_010669618.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731318252|ref|XP_010669619.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Beta vulgaris subsp. vulgaris] gi|731318254|ref|XP_010669620.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Beta vulgaris subsp. vulgaris] gi|870866720|gb|KMT17653.1| hypothetical protein BVRB_2g036010 [Beta vulgaris subsp. vulgaris] Length = 780 Score = 69.3 bits (168), Expect = 9e-10 Identities = 37/83 (44%), Positives = 55/83 (66%), Gaps = 3/83 (3%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSF---STADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGN 73 M + K L++R F+S+ ST +NY++ ++SFLS+ L SLL HA +I +GN Sbjct: 1 MLKFKQNSLFRRFFNSYLQPSTTSQTTNYINCCLDSFLSHQFLPSQSLLPSHAIVIISGN 60 Query: 72 TDNIFIASKLIAHYASLNQPHSS 4 +N+FIASKLI+ YASL++P S Sbjct: 61 NNNVFIASKLISLYASLSRPELS 83 >ref|XP_009791059.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Nicotiana sylvestris] Length = 778 Score = 69.3 bits (168), Expect = 9e-10 Identities = 39/78 (50%), Positives = 52/78 (66%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDN 64 MFR K L F T + S+YLH+ IN+FLSN D +L Q HA+IITTG+T+N Sbjct: 1 MFRTKLQKLCYPSSIEFPT-ETTSHYLHHRINTFLSNKTSDLKTLHQSHAFIITTGHTNN 59 Query: 63 IFIASKLIAHYASLNQPH 10 ++IA+KLI+ YAS N+ H Sbjct: 60 VYIAAKLISLYAS-NKHH 76 >ref|XP_008459184.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cucumis melo] gi|659118563|ref|XP_008459185.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cucumis melo] Length = 829 Score = 68.9 bits (167), Expect = 1e-09 Identities = 37/78 (47%), Positives = 52/78 (66%), Gaps = 1/78 (1%) Frame = -3 Query: 243 MFRIKFTHLYKRL-FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTD 67 M R++ + + R FSS T+ +Y +N ++SF S +L F SLLQ H+ IITTGN+D Sbjct: 56 MLRLRLSQFHIRFAFSSTFTSLPDPHYPNNCLHSFFSKPSLTFQSLLQFHSLIITTGNSD 115 Query: 66 NIFIASKLIAHYASLNQP 13 N+F A+KL+A YAS QP Sbjct: 116 NVFFATKLMAFYASHRQP 133 >ref|XP_008365867.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial-like [Malus domestica] Length = 780 Score = 67.0 bits (162), Expect = 5e-09 Identities = 39/83 (46%), Positives = 56/83 (67%), Gaps = 6/83 (7%) Frame = -3 Query: 243 MFRIKFTHLYKRL------FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIIT 82 M R K +L++RL F SFS+ SNYL+ H++SFLS+ L Q HA I++ Sbjct: 3 MLRHKPLYLFERLPSFSRPFCSFSS----SNYLNRHLDSFLSDQLPTLXHLSQSHALIVS 58 Query: 81 TGNTDNIFIASKLIAHYASLNQP 13 +GN++NIFIA+KLI+ YASL++P Sbjct: 59 SGNSNNIFIAAKLISLYASLSKP 81 >ref|XP_009370728.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial, partial [Pyrus x bretschneideri] Length = 762 Score = 66.2 bits (160), Expect = 8e-09 Identities = 37/67 (55%), Positives = 47/67 (70%) Frame = -3 Query: 204 FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDNIFIASKLIAHYAS 25 FSS S AS YL+ H++SFLSN F L Q HA IIT+ N++NIFI +KLI+ YAS Sbjct: 4 FSSLS----ASEYLNYHLDSFLSNQIPTFQHLSQSHALIITSANSNNIFICAKLISLYAS 59 Query: 24 LNQPHSS 4 L++P SS Sbjct: 60 LSKPTSS 66 >ref|XP_012489272.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184664|ref|XP_012489273.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184667|ref|XP_012489274.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184670|ref|XP_012489275.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184673|ref|XP_012489276.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184676|ref|XP_012489277.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184679|ref|XP_012489278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|823184682|ref|XP_012489279.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Gossypium raimondii] gi|763773244|gb|KJB40367.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773245|gb|KJB40368.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773246|gb|KJB40369.1| hypothetical protein B456_007G060400 [Gossypium raimondii] gi|763773247|gb|KJB40370.1| hypothetical protein B456_007G060400 [Gossypium raimondii] Length = 785 Score = 65.9 bits (159), Expect = 1e-08 Identities = 44/90 (48%), Positives = 59/90 (65%), Gaps = 10/90 (11%) Frame = -3 Query: 243 MFRIKFTHLYKRLFSS-------FSTADIASNYLHNHINSFLSNSALD--FNSLLQIHAY 91 M ++K T L K+ F+S +ST SNYL+ H++SFLS +A SLLQ HA Sbjct: 1 MLKLKPTRLLKQHFASPHYLLLFYST----SNYLNCHLDSFLSTNAASSTVKSLLQSHAL 56 Query: 90 IITTGNT-DNIFIASKLIAHYASLNQPHSS 4 IIT+GN+ DNIFI+SKLI+ YA N+P+ S Sbjct: 57 IITSGNSNDNIFISSKLISLYAFFNKPNCS 86 >ref|XP_004148109.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Cucumis sativus] gi|700208288|gb|KGN63407.1| hypothetical protein Csa_2G439160 [Cucumis sativus] Length = 784 Score = 64.3 bits (155), Expect = 3e-08 Identities = 35/78 (44%), Positives = 51/78 (65%), Gaps = 1/78 (1%) Frame = -3 Query: 243 MFRIKFTHLYKRL-FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTD 67 M R++ + + R FSS T+ S+Y +N ++SF S L F SLLQ H+ IITTGN++ Sbjct: 11 MLRLRLSQFHIRFAFSSTFTSLSDSHYPNNCLHSFFSKPNLTFQSLLQFHSLIITTGNSN 70 Query: 66 NIFIASKLIAHYASLNQP 13 N+F A+KL+A YA +P Sbjct: 71 NVFFATKLMAFYAYHRKP 88 >ref|XP_010662158.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422578|ref|XP_010662160.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422580|ref|XP_010662161.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422582|ref|XP_010662162.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] gi|731422584|ref|XP_010662163.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Vitis vinifera] Length = 782 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/87 (41%), Positives = 57/87 (65%) Frame = -3 Query: 264 LPIKNFHMFRIKFTHLYKRLFSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYII 85 L +K H+F+ + L +RL+ S + + +++ N++N LSN +LLQ HA+II Sbjct: 2 LSLKPTHLFKHCSSLLQQRLYCSPTWSHEPNDF--NYLNHLLSNQISSLKTLLQSHAFII 59 Query: 84 TTGNTDNIFIASKLIAHYASLNQPHSS 4 T+G ++NIFIASKLI+ YAS ++P S Sbjct: 60 TSGYSNNIFIASKLISLYASFHKPSCS 86 >emb|CBI26593.3| unnamed protein product [Vitis vinifera] Length = 459 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/87 (41%), Positives = 57/87 (65%) Frame = -3 Query: 264 LPIKNFHMFRIKFTHLYKRLFSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYII 85 L +K H+F+ + L +RL+ S + + +++ N++N LSN +LLQ HA+II Sbjct: 2 LSLKPTHLFKHCSSLLQQRLYCSPTWSHEPNDF--NYLNHLLSNQISSLKTLLQSHAFII 59 Query: 84 TTGNTDNIFIASKLIAHYASLNQPHSS 4 T+G ++NIFIASKLI+ YAS ++P S Sbjct: 60 TSGYSNNIFIASKLISLYASFHKPSCS 86 >ref|XP_007047919.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508700180|gb|EOX92076.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 784 Score = 63.9 bits (154), Expect = 4e-08 Identities = 44/89 (49%), Positives = 55/89 (61%), Gaps = 9/89 (10%) Frame = -3 Query: 243 MFRIKFTHLYKRL------FSSFSTADIASNYLHNHINSFLSN--SALDFNSLLQIHAYI 88 M ++K T + + SS ST S YL+ ++SFLSN S+ SLLQ HA I Sbjct: 1 MLKLKATQMLRHFPSTSLQLSSCST----SGYLNCQLHSFLSNNPSSSTLQSLLQSHALI 56 Query: 87 ITTGN-TDNIFIASKLIAHYASLNQPHSS 4 ITTGN T+NIFIASKLI+ YA N+PH S Sbjct: 57 ITTGNSTNNIFIASKLISLYAFFNKPHFS 85 >ref|XP_008382134.1| PREDICTED: pentatricopeptide repeat-containing protein At4g39952, mitochondrial [Malus domestica] Length = 780 Score = 63.5 bits (153), Expect = 5e-08 Identities = 36/76 (47%), Positives = 52/76 (68%), Gaps = 6/76 (7%) Frame = -3 Query: 222 HLYKRL------FSSFSTADIASNYLHNHINSFLSNSALDFNSLLQIHAYIITTGNTDNI 61 +L++RL F SFS+ SNYL+ H++SFLS+ L Q HA I+++GN++NI Sbjct: 10 YLFERLPSXSXPFCSFSS----SNYLNRHLDSFLSDQLPTLXHLSQSHALIVSSGNSNNI 65 Query: 60 FIASKLIAHYASLNQP 13 FIA+KLI+ YASL+ P Sbjct: 66 FIAAKLISLYASLSXP 81