BLASTX nr result
ID: Forsythia21_contig00032627
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032627 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EFA11824.1| hypothetical protein TcasGA2_TC011501 [Tribolium ... 57 5e-06 >gb|EFA11824.1| hypothetical protein TcasGA2_TC011501 [Tribolium castaneum] Length = 251 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 4/50 (8%) Frame = +3 Query: 3 QGRNQRDMMNRAYWEFLVHGQQLQSPIP----NHGVYF*LPRPFGRGFSR 140 Q RNQR++M RAYWEFLVHG+QLQ+PIP N+ Y PF R S+ Sbjct: 8 QERNQRELMTRAYWEFLVHGEQLQAPIPSTKENNRQYLSAQAPFNRILSK 57