BLASTX nr result
ID: Forsythia21_contig00032602
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032602 (398 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012845451.1| PREDICTED: lysine histidine transporter-like... 45 4e-08 ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like... 45 1e-07 ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like... 45 1e-07 emb|CDP07603.1| unnamed protein product [Coffea canephora] 45 2e-07 >ref|XP_012845451.1| PREDICTED: lysine histidine transporter-like 8 [Erythranthe guttatus] gi|604346690|gb|EYU45070.1| hypothetical protein MIMGU_mgv1a004478mg [Erythranthe guttata] Length = 525 Score = 45.4 bits (106), Expect(2) = 4e-08 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 244 EKPETELISIPAKPRASTPEILTLS 318 E+PETELISIPA PRASTPEILT S Sbjct: 3 ERPETELISIPATPRASTPEILTPS 27 Score = 38.5 bits (88), Expect(2) = 4e-08 Identities = 20/34 (58%), Positives = 22/34 (64%), Gaps = 7/34 (20%) Frame = +3 Query: 318 GQRSPRKES-------GTTKLWTPTSFIWPKFLS 398 GQRSPR + GT K WTPTSFI P+FLS Sbjct: 28 GQRSPRAMAREAALGTGTAKSWTPTSFISPRFLS 61 >ref|XP_006354939.1| PREDICTED: lysine histidine transporter-like 8-like [Solanum tuberosum] Length = 525 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 244 EKPETELISIPAKPRASTPEILTLS 318 E+PETELISIPA PRASTPEILT S Sbjct: 3 ERPETELISIPATPRASTPEILTPS 27 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 8/35 (22%) Frame = +3 Query: 318 GQRSPRKESGTT--------KLWTPTSFIWPKFLS 398 GQRSPR G T K WTPTSFI P+FLS Sbjct: 28 GQRSPRGGGGHTSTGASKDAKSWTPTSFISPRFLS 62 >ref|XP_004238196.1| PREDICTED: lysine histidine transporter-like 8 [Solanum lycopersicum] Length = 525 Score = 45.4 bits (106), Expect(2) = 1e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 244 EKPETELISIPAKPRASTPEILTLS 318 E+PETELISIPA PRASTPEILT S Sbjct: 3 ERPETELISIPATPRASTPEILTPS 27 Score = 36.6 bits (83), Expect(2) = 1e-07 Identities = 20/35 (57%), Positives = 21/35 (60%), Gaps = 8/35 (22%) Frame = +3 Query: 318 GQRSPRKESGTT--------KLWTPTSFIWPKFLS 398 GQRSPR G T K WTPTSFI P+FLS Sbjct: 28 GQRSPRGGGGHTSTGASKDAKSWTPTSFISPRFLS 62 >emb|CDP07603.1| unnamed protein product [Coffea canephora] Length = 523 Score = 45.4 bits (106), Expect(2) = 2e-07 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = +1 Query: 244 EKPETELISIPAKPRASTPEILTLS 318 E+PETELISIPA PRASTPEILT S Sbjct: 3 ERPETELISIPATPRASTPEILTPS 27 Score = 35.8 bits (81), Expect(2) = 2e-07 Identities = 19/33 (57%), Positives = 21/33 (63%), Gaps = 6/33 (18%) Frame = +3 Query: 318 GQRSPRKESGT------TKLWTPTSFIWPKFLS 398 GQRSPR + T K WTPTSFI P+FLS Sbjct: 28 GQRSPRGLASTGPASKEAKSWTPTSFISPRFLS 60