BLASTX nr result
ID: Forsythia21_contig00032589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032589 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099096.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] 66 1e-08 dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] 62 2e-07 ref|XP_011097241.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] 57 5e-06 >ref|XP_011099096.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] Length = 370 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = +2 Query: 152 MVSHFQEQESLVQNPIFDALYCEEERFDEVVKGGFDFRSP 271 MVSHF EQESL NPIFDALYCEEERFDE GGF + P Sbjct: 1 MVSHFYEQESLHHNPIFDALYCEEERFDECAGGGFGLKEP 40 >dbj|BAE06272.1| cyclin D [Scutellaria baicalensis] Length = 372 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%) Frame = +2 Query: 152 MVSHFQEQESLVQNPIFDALYCEEERFDEVVKG-GFDFRSP 271 MVS FQE ESL+QNPIFDALYC+EERFDE V G G F+ P Sbjct: 1 MVSEFQEHESLLQNPIFDALYCDEERFDECVGGAGSGFKEP 41 >ref|XP_011097241.1| PREDICTED: cyclin-D3-3-like [Sesamum indicum] Length = 367 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = +2 Query: 152 MVSHFQEQESLVQNPIFDALYCEEERFDEVVKGGFDFR 265 MVS QEQ+ L+QNP+FDALYCEEERFDE + GG + Sbjct: 1 MVSRLQEQDLLLQNPVFDALYCEEERFDEDLGGGLGLK 38