BLASTX nr result
ID: Forsythia21_contig00032527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032527 (230 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29980.1| hypothetical protein MIMGU_mgv1a025609mg [Erythra... 57 4e-06 >gb|EYU29980.1| hypothetical protein MIMGU_mgv1a025609mg [Erythranthe guttata] Length = 109 Score = 57.4 bits (137), Expect = 4e-06 Identities = 39/81 (48%), Positives = 48/81 (59%), Gaps = 12/81 (14%) Frame = +3 Query: 24 LVALLIISVLHIWVPRESKVIAIRIFP---AAVEEDTKSILE--------SNKNQTNIFH 170 LVALLIIS+ H+W+ +++V AIRI A EED E + KNQT IF Sbjct: 15 LVALLIISLAHLWISSQTQVEAIRILRQRWLAAEEDQSHYTEPPPPPPSPAGKNQTEIFR 74 Query: 171 KYFNDTVVSDLNTTS-NGMFL 230 +YF VSDLNTT+ NG FL Sbjct: 75 EYFKGR-VSDLNTTTKNGTFL 94