BLASTX nr result
ID: Forsythia21_contig00032440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032440 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO99598.1| unnamed protein product [Coffea canephora] 57 4e-06 >emb|CDO99598.1| unnamed protein product [Coffea canephora] Length = 843 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +2 Query: 110 WHETFVSWMAEKTWSHKGYIPSADE*LQTGMISI 211 W ETF+SWM EKTWS GY+PS +E L+TGM+SI Sbjct: 593 WRETFLSWMTEKTWSDTGYLPSMEEYLETGMVSI 626