BLASTX nr result
ID: Forsythia21_contig00032254
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00032254 (356 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012849603.1| PREDICTED: disease resistance protein RPM1-l... 74 4e-11 >ref|XP_012849603.1| PREDICTED: disease resistance protein RPM1-like [Erythranthe guttatus] Length = 960 Score = 73.9 bits (180), Expect = 4e-11 Identities = 30/46 (65%), Positives = 39/46 (84%), Gaps = 2/46 (4%) Frame = -3 Query: 354 HIPEVYHTYWRNGCWEVHPLDKKQTIEKSGQ--TAIVRTQEQRNWL 223 H+PEVYHTYWRNGCWEV+ LD ++ E++G+ A+V+TQEQRNWL Sbjct: 915 HVPEVYHTYWRNGCWEVYALDDERVNEEAGKNGAAVVKTQEQRNWL 960