BLASTX nr result
ID: Forsythia21_contig00031313
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031313 (271 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090847.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 80 7e-13 emb|CDO98913.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_009763391.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 59 1e-06 ref|XP_009596740.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-... 57 4e-06 >ref|XP_011090847.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Sesamum indicum] Length = 420 Score = 79.7 bits (195), Expect = 7e-13 Identities = 46/79 (58%), Positives = 53/79 (67%), Gaps = 6/79 (7%) Frame = -1 Query: 220 MSICPTFNFNSLTIHSPK----KRFFSSHLINEIQVTKFPYAFP--SVILSEPFKFSKER 59 MSI F+ N LT S K KR FS HLI+++QVT PYA P SV LS+P +FSKER Sbjct: 1 MSISTPFSSNGLTYQSSKSRSFKRHFSYHLISQVQVTTVPYAIPLPSVYLSKPKRFSKER 60 Query: 58 FKFGTVLATQTVETPKVSF 2 FK T AT TVETPK+SF Sbjct: 61 FKLVTASATPTVETPKISF 79 >emb|CDO98913.1| unnamed protein product [Coffea canephora] Length = 415 Score = 61.2 bits (147), Expect = 3e-07 Identities = 39/77 (50%), Positives = 45/77 (58%), Gaps = 4/77 (5%) Frame = -1 Query: 220 MSICPTFNFNSLTIHSPKKRFF----SSHLINEIQVTKFPYAFPSVILSEPFKFSKERFK 53 MSIC +N L +HSPK F SS+ IN IQV PY+ PS+ LS PFKF KER Sbjct: 1 MSICAAYN--GLALHSPKAESFRGLISSNFINRIQVRPAPYS-PSLHLSGPFKFGKERCH 57 Query: 52 FGTVLATQTVETPKVSF 2 + AT TVE K SF Sbjct: 58 LISASATPTVECSKTSF 74 >ref|XP_009763391.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Nicotiana sylvestris] Length = 416 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = -1 Query: 196 FNSLTIHSPK----KRFFSSHLINEIQVTKFPYAFPSVILSEPFKFSKERFKFGTVLATQ 29 F+ LT+ S K K+ SSH IN +QV+ PYA P + ++ PF+ + + K T LA Sbjct: 7 FSKLTLQSTKDHNFKQLLSSHFINHVQVSTVPYAIPFLSVNVPFRVNSRKLKPITALAAS 66 Query: 28 TVETPKVSF 2 T+E+PK+SF Sbjct: 67 TIESPKISF 75 >ref|XP_009596740.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Nicotiana tomentosiformis] gi|697175599|ref|XP_009596741.1| PREDICTED: divinyl chlorophyllide a 8-vinyl-reductase, chloroplastic [Nicotiana tomentosiformis] Length = 416 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/69 (40%), Positives = 43/69 (62%), Gaps = 4/69 (5%) Frame = -1 Query: 196 FNSLTIHSPK----KRFFSSHLINEIQVTKFPYAFPSVILSEPFKFSKERFKFGTVLATQ 29 F+ LT+ S K ++ SSH IN +QV+ PYA P + ++ PF+ + + K TV A Sbjct: 7 FSGLTLQSTKDHNFRQLLSSHFINHVQVSTVPYAIPFLSVNVPFRVNSRKLKPITVSAAS 66 Query: 28 TVETPKVSF 2 T+E+PK+SF Sbjct: 67 TIESPKISF 75