BLASTX nr result
ID: Forsythia21_contig00031042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00031042 (295 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KIX93783.1| 40S ribosomal protein S11 [Fonsecaea multimorphos... 66 1e-08 gb|KIW98718.1| 40S ribosomal protein S11 [Cladophialophora banti... 66 1e-08 gb|KIW80430.1| 40S ribosomal protein S11 [Fonsecaea pedrosoi CBS... 66 1e-08 gb|KIW42686.1| 40S ribosomal protein S11 [Exophiala oligosperma] 66 1e-08 gb|KIW17565.1| 40S ribosomal protein S11 [Exophiala spinifera] 66 1e-08 ref|XP_003024169.1| hypothetical protein TRV_01668 [Trichophyton... 66 1e-08 ref|XP_003015887.1| hypothetical protein ARB_06199 [Arthroderma ... 66 1e-08 gb|EZF24359.1| 40S ribosomal protein S11 [Trichophyton rubrum MR... 66 1e-08 ref|XP_007739187.1| 40S ribosomal protein S11 [Cladophialophora ... 66 1e-08 ref|XP_007753775.1| 40S ribosomal protein S11 [Cladophialophora ... 66 1e-08 ref|XP_008723287.1| 40S ribosomal protein S11 [Cladophialophora ... 66 1e-08 ref|XP_007678236.1| hypothetical protein BAUCODRAFT_74231 [Baudo... 66 1e-08 gb|EGE06855.1| 40S ribosomal protein S11 [Trichophyton equinum C... 66 1e-08 ref|XP_003233956.1| 40S ribosomal protein S11 [Trichophyton rubr... 66 1e-08 ref|XP_003170224.1| 40S ribosomal protein S11 [Microsporum gypse... 66 1e-08 gb|KIX00453.1| 40S ribosomal protein S11 [Rhinocladiella mackenz... 65 1e-08 gb|KIW72189.1| 40S ribosomal protein S11 [Capronia semiimmersa] 65 2e-08 gb|KIW61958.1| 40S ribosomal protein S11 [Exophiala xenobiotica] 65 2e-08 gb|KIW30255.1| 40S ribosomal protein S11 [Cladophialophora immunda] 65 2e-08 gb|KIV94214.1| 40S ribosomal protein S11 [Exophiala mesophila] 65 2e-08 >gb|KIX93783.1| 40S ribosomal protein S11 [Fonsecaea multimorphosa CBS 102226] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >gb|KIW98718.1| 40S ribosomal protein S11 [Cladophialophora bantiana CBS 173.52] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >gb|KIW80430.1| 40S ribosomal protein S11 [Fonsecaea pedrosoi CBS 271.37] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >gb|KIW42686.1| 40S ribosomal protein S11 [Exophiala oligosperma] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >gb|KIW17565.1| 40S ribosomal protein S11 [Exophiala spinifera] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >ref|XP_003024169.1| hypothetical protein TRV_01668 [Trichophyton verrucosum HKI 0517] gi|291188214|gb|EFE43558.1| hypothetical protein TRV_01668 [Trichophyton verrucosum HKI 0517] Length = 196 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 166 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 196 >ref|XP_003015887.1| hypothetical protein ARB_06199 [Arthroderma benhamiae CBS 112371] gi|291179455|gb|EFE35242.1| hypothetical protein ARB_06199 [Arthroderma benhamiae CBS 112371] Length = 77 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 47 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 77 >gb|EZF24359.1| 40S ribosomal protein S11 [Trichophyton rubrum MR850] gi|607906048|gb|EZF43320.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 100081] gi|607918141|gb|EZF53962.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 288.86] gi|607930165|gb|EZF64545.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 289.86] gi|607942101|gb|EZF75192.1| 40S ribosomal protein S11 [Trichophyton soudanense CBS 452.61] gi|607954236|gb|EZF85889.1| 40S ribosomal protein S11 [Trichophyton rubrum MR1448] gi|607966446|gb|EZF96670.1| 40S ribosomal protein S11 [Trichophyton rubrum MR1459] gi|607978738|gb|EZG07798.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 735.88] gi|607990293|gb|EZG18111.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 202.88] gi|633060545|gb|KDB35154.1| 40S ribosomal protein S11 [Trichophyton rubrum D6] gi|674808355|gb|EGD89587.2| 40S ribosomal protein S11 [Trichophyton rubrum CBS 118892] Length = 285 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 255 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 285 >ref|XP_007739187.1| 40S ribosomal protein S11 [Cladophialophora psammophila CBS 110553] gi|589993340|gb|EXJ75870.1| 40S ribosomal protein S11 [Cladophialophora psammophila CBS 110553] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >ref|XP_007753775.1| 40S ribosomal protein S11 [Cladophialophora yegresii CBS 114405] gi|589981967|gb|EXJ65208.1| 40S ribosomal protein S11 [Cladophialophora yegresii CBS 114405] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >ref|XP_008723287.1| 40S ribosomal protein S11 [Cladophialophora carrionii CBS 160.54] gi|565940107|gb|ETI29213.1| 40S ribosomal protein S11 [Cladophialophora carrionii CBS 160.54] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >ref|XP_007678236.1| hypothetical protein BAUCODRAFT_74231 [Baudoinia compniacensis UAMH 10762] gi|449298708|gb|EMC94723.1| hypothetical protein BAUCODRAFT_74231 [Baudoinia compniacensis UAMH 10762] Length = 162 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 162 >gb|EGE06855.1| 40S ribosomal protein S11 [Trichophyton equinum CBS 127.97] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 131 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 161 >ref|XP_003233956.1| 40S ribosomal protein S11 [Trichophyton rubrum CBS 118892] gi|326474651|gb|EGD98660.1| 40S ribosomal protein S11 [Trichophyton tonsurans CBS 112818] gi|607893626|gb|EZF32702.1| 40S ribosomal protein S11 [Trichophyton interdigitale H6] gi|633049736|gb|KDB25853.1| 40S ribosomal protein S11 [Trichophyton interdigitale MR816] gi|861299844|gb|KMQ44111.1| Nucleic acid-binding, OB-fold [Trichophyton rubrum] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 131 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 161 >ref|XP_003170224.1| 40S ribosomal protein S11 [Microsporum gypseum CBS 118893] gi|311345258|gb|EFR04461.1| 40S ribosomal protein S11 [Microsporum gypseum CBS 118893] Length = 161 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF Sbjct: 131 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 161 >gb|KIX00453.1| 40S ribosomal protein S11 [Rhinocladiella mackenziei CBS 650.93] Length = 162 Score = 65.5 bits (158), Expect = 1e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKA+KAFQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAIKAFQKF 162 >gb|KIW72189.1| 40S ribosomal protein S11 [Capronia semiimmersa] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVK+FQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKSFQKF 162 >gb|KIW61958.1| 40S ribosomal protein S11 [Exophiala xenobiotica] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVK+FQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKSFQKF 162 >gb|KIW30255.1| 40S ribosomal protein S11 [Cladophialophora immunda] Length = 162 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVK+FQKF Sbjct: 132 GQCRPLSKTVRFNVLRVLPRTGKAVKSFQKF 162 >gb|KIV94214.1| 40S ribosomal protein S11 [Exophiala mesophila] Length = 161 Score = 64.7 bits (156), Expect = 2e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 1 GQCRPLSKTVRFNVLRVLPRTGKAVKAFQKF 93 GQCRPLSKTVRFNVLRVLPRTGKAVK+FQKF Sbjct: 131 GQCRPLSKTVRFNVLRVLPRTGKAVKSFQKF 161