BLASTX nr result
ID: Forsythia21_contig00030952
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030952 (333 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853023.1| PREDICTED: tryptophan aminotransferase-relat... 60 7e-07 ref|XP_011100603.1| PREDICTED: tryptophan aminotransferase-relat... 60 7e-07 gb|EYU24346.1| hypothetical protein MIMGU_mgv1a008741mg [Erythra... 60 7e-07 ref|XP_011100941.1| PREDICTED: tryptophan aminotransferase-relat... 57 4e-06 ref|XP_011100906.1| PREDICTED: tryptophan aminotransferase-relat... 56 8e-06 >ref|XP_012853023.1| PREDICTED: tryptophan aminotransferase-related protein 4-like isoform X1 [Erythranthe guttatus] Length = 463 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 2 RLGSLFNSEDRYVRLSLLKRDDDFNFLLYRLKELISKEGGAET 130 R GSLF+ EDRYVRLSLLK DDDFN L+ L +L+++E GA+T Sbjct: 417 REGSLFSDEDRYVRLSLLKSDDDFNLLMDHLSKLVAEENGAKT 459 >ref|XP_011100603.1| PREDICTED: tryptophan aminotransferase-related protein 4-like [Sesamum indicum] Length = 452 Score = 59.7 bits (143), Expect = 7e-07 Identities = 29/44 (65%), Positives = 36/44 (81%) Frame = +2 Query: 2 RLGSLFNSEDRYVRLSLLKRDDDFNFLLYRLKELISKEGGAETL 133 R GSLF S+DRYVRLSLL+ DDF+ LL RL +LIS+E GA+T+ Sbjct: 409 REGSLFESDDRYVRLSLLRSQDDFDLLLRRLNDLISEEKGAQTM 452 >gb|EYU24346.1| hypothetical protein MIMGU_mgv1a008741mg [Erythranthe guttata] Length = 364 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 2 RLGSLFNSEDRYVRLSLLKRDDDFNFLLYRLKELISKEGGAET 130 R GSLF+ EDRYVRLSLLK DDDFN L+ L +L+++E GA+T Sbjct: 318 REGSLFSDEDRYVRLSLLKSDDDFNLLMDHLSKLVAEENGAKT 360 >ref|XP_011100941.1| PREDICTED: tryptophan aminotransferase-related protein 4-like [Sesamum indicum] Length = 461 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 2 RLGSLFNSEDRYVRLSLLKRDDDFNFLLYRLKELISKE 115 R GSLFN EDRYVRLSLLK DDDFN LL RL +L++++ Sbjct: 414 RAGSLFNVEDRYVRLSLLKSDDDFNLLLLRLDKLVTQD 451 >ref|XP_011100906.1| PREDICTED: tryptophan aminotransferase-related protein 4-like [Sesamum indicum] Length = 459 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +2 Query: 2 RLGSLFNSEDRYVRLSLLKRDDDFNFLLYRLKELISKEGGAETL 133 R G FN+EDRYVRLSL+K DDFN LL RLKEL+S E +TL Sbjct: 413 REGGSFNAEDRYVRLSLVKSADDFNLLLDRLKELVSMEEQNQTL 456