BLASTX nr result
ID: Forsythia21_contig00030931
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia21_contig00030931 (294 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Popu... 126 7e-27 ref|XP_011010512.1| PREDICTED: HD domain-containing protein 2-li... 125 1e-26 ref|XP_010268406.1| PREDICTED: HD domain-containing protein 2-li... 124 2e-26 ref|XP_010525763.1| PREDICTED: HD domain-containing protein 2 [T... 124 2e-26 ref|XP_010103124.1| HD domain-containing protein 2 [Morus notabi... 123 6e-26 ref|XP_010429340.1| PREDICTED: HD domain-containing protein 2-li... 121 2e-25 ref|XP_010417127.1| PREDICTED: HD domain-containing protein 2-li... 121 2e-25 ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-li... 121 2e-25 ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2 [S... 121 2e-25 ref|XP_011069825.1| PREDICTED: HD domain-containing protein 2 [S... 120 4e-25 ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis t... 120 4e-25 dbj|BAE99246.1| hypothetical protein [Arabidopsis thaliana] 120 4e-25 gb|KDO62343.1| hypothetical protein CISIN_1g025188mg [Citrus sin... 120 5e-25 ref|XP_006453513.1| hypothetical protein CICLE_v10009257mg [Citr... 120 5e-25 ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-c... 119 6e-25 ref|XP_004309776.2| PREDICTED: HD domain-containing protein 2 [F... 119 1e-24 ref|XP_010904602.1| PREDICTED: HD domain-containing protein 2 is... 119 1e-24 ref|XP_009772323.1| PREDICTED: HD domain-containing protein 2 ho... 119 1e-24 ref|XP_009626145.1| PREDICTED: HD domain-containing protein 2 ho... 119 1e-24 ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Caps... 119 1e-24 >ref|XP_002309375.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] gi|550336643|gb|EEE92898.2| hypothetical protein POPTR_0006s19250g [Populus trichocarpa] Length = 248 Score = 126 bits (316), Expect = 7e-27 Identities = 62/64 (96%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTE+GKAWA EIAS Sbjct: 183 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWALEIAS 242 Query: 114 RRRK 103 RRRK Sbjct: 243 RRRK 246 >ref|XP_011010512.1| PREDICTED: HD domain-containing protein 2-like [Populus euphratica] gi|743932448|ref|XP_011010513.1| PREDICTED: HD domain-containing protein 2-like [Populus euphratica] gi|743932450|ref|XP_011010514.1| PREDICTED: HD domain-containing protein 2-like [Populus euphratica] gi|743932604|ref|XP_011010596.1| PREDICTED: HD domain-containing protein 2-like [Populus euphratica] gi|743932606|ref|XP_011010597.1| PREDICTED: HD domain-containing protein 2-like [Populus euphratica] Length = 248 Score = 125 bits (313), Expect = 1e-26 Identities = 61/64 (95%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEEN+TPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTE+GKAWA EIAS Sbjct: 183 YEENTTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWALEIAS 242 Query: 114 RRRK 103 RRRK Sbjct: 243 RRRK 246 >ref|XP_010268406.1| PREDICTED: HD domain-containing protein 2-like [Nelumbo nucifera] Length = 222 Score = 124 bits (312), Expect = 2e-26 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYENEQG DL+EFFQSTAGKFQT+LGKAWASEIAS Sbjct: 157 YEENSSPEAKVVKDFDKVEMILQALEYENEQGADLDEFFQSTAGKFQTDLGKAWASEIAS 216 Query: 114 RRRK*H 97 RRRK H Sbjct: 217 RRRKEH 222 >ref|XP_010525763.1| PREDICTED: HD domain-containing protein 2 [Tarenaya hassleriana] Length = 264 Score = 124 bits (311), Expect = 2e-26 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTE+GKAWA EIAS Sbjct: 199 YEENSSPEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEIGKAWALEIAS 258 Query: 114 RRRK*H 97 RRR H Sbjct: 259 RRRSKH 264 >ref|XP_010103124.1| HD domain-containing protein 2 [Morus notabilis] gi|587906849|gb|EXB94889.1| HD domain-containing protein 2 [Morus notabilis] Length = 262 Score = 123 bits (308), Expect = 6e-26 Identities = 59/64 (92%), Positives = 64/64 (100%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYE+EQGKDL+EFFQSTAGKFQTELGKAWASEIAS Sbjct: 197 YEENSSPEAKVVKDFDKVEMILQALEYESEQGKDLDEFFQSTAGKFQTELGKAWASEIAS 256 Query: 114 RRRK 103 RR+K Sbjct: 257 RRQK 260 >ref|XP_010429340.1| PREDICTED: HD domain-containing protein 2-like [Camelina sativa] Length = 261 Score = 121 bits (303), Expect = 2e-25 Identities = 58/66 (87%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYE QGKDLEEFFQSTAGKFQT++GKAWASEI S Sbjct: 196 YEENSSPEAKVVKDFDKVEMILQALEYEQAQGKDLEEFFQSTAGKFQTDIGKAWASEIVS 255 Query: 114 RRRK*H 97 RRRK H Sbjct: 256 RRRKQH 261 >ref|XP_010417127.1| PREDICTED: HD domain-containing protein 2-like [Camelina sativa] Length = 258 Score = 121 bits (303), Expect = 2e-25 Identities = 58/66 (87%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYE QGKDLEEFFQSTAGKFQT++GKAWASEI S Sbjct: 193 YEENSSPEAKVVKDFDKVEMILQALEYEQAQGKDLEEFFQSTAGKFQTDIGKAWASEIVS 252 Query: 114 RRRK*H 97 RRRK H Sbjct: 253 RRRKQH 258 >ref|XP_006343571.1| PREDICTED: HD domain-containing protein 2-like [Solanum tuberosum] Length = 241 Score = 121 bits (303), Expect = 2e-25 Identities = 58/64 (90%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+ EAK+VKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTE+GKAWASE+AS Sbjct: 176 YEENSSLEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVAS 235 Query: 114 RRRK 103 RR+K Sbjct: 236 RRKK 239 >ref|XP_004242640.1| PREDICTED: HD domain-containing protein 2 [Solanum lycopersicum] Length = 242 Score = 121 bits (303), Expect = 2e-25 Identities = 58/64 (90%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+ EAK+VKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTE+GKAWASE+AS Sbjct: 177 YEENSSLEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTEVGKAWASEVAS 236 Query: 114 RRRK 103 RR+K Sbjct: 237 RRKK 240 >ref|XP_011069825.1| PREDICTED: HD domain-containing protein 2 [Sesamum indicum] Length = 237 Score = 120 bits (301), Expect = 4e-25 Identities = 57/64 (89%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+ EAK+VKDFDKVEMILQALEYEN+QGKDLEEFF+STAGKFQT+LGKAWASE+AS Sbjct: 173 YEENSSMEAKVVKDFDKVEMILQALEYENDQGKDLEEFFESTAGKFQTDLGKAWASEVAS 232 Query: 114 RRRK 103 RRRK Sbjct: 233 RRRK 236 >ref|NP_973522.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] gi|50253436|gb|AAT71920.1| At2g23820 [Arabidopsis thaliana] gi|58331781|gb|AAW70388.1| At2g23820 [Arabidopsis thaliana] gi|330252401|gb|AEC07495.1| Metal-dependent phosphohydrolase [Arabidopsis thaliana] Length = 257 Score = 120 bits (301), Expect = 4e-25 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVE+ILQALEYE +QGKDLEEFFQSTAGKFQT +GKAWASEI S Sbjct: 192 YEENSSPEAKVVKDFDKVELILQALEYEQDQGKDLEEFFQSTAGKFQTNIGKAWASEIVS 251 Query: 114 RRRK*H 97 RRRK H Sbjct: 252 RRRKQH 257 >dbj|BAE99246.1| hypothetical protein [Arabidopsis thaliana] Length = 254 Score = 120 bits (301), Expect = 4e-25 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVE+ILQALEYE +QGKDLEEFFQSTAGKFQT +GKAWASEI S Sbjct: 189 YEENSSPEAKVVKDFDKVELILQALEYEQDQGKDLEEFFQSTAGKFQTNIGKAWASEIVS 248 Query: 114 RRRK*H 97 RRRK H Sbjct: 249 RRRKQH 254 >gb|KDO62343.1| hypothetical protein CISIN_1g025188mg [Citrus sinensis] Length = 256 Score = 120 bits (300), Expect = 5e-25 Identities = 58/64 (90%), Positives = 61/64 (95%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENST EAKIVKDFDK EMILQA+EYENEQGKDLEEFFQSTAGKFQTELGKAWA+EI S Sbjct: 193 YEENSTAEAKIVKDFDKAEMILQAVEYENEQGKDLEEFFQSTAGKFQTELGKAWAAEIVS 252 Query: 114 RRRK 103 RR+K Sbjct: 253 RRKK 256 >ref|XP_006453513.1| hypothetical protein CICLE_v10009257mg [Citrus clementina] gi|568840247|ref|XP_006474081.1| PREDICTED: HD domain-containing protein 2-like [Citrus sinensis] gi|557556739|gb|ESR66753.1| hypothetical protein CICLE_v10009257mg [Citrus clementina] Length = 256 Score = 120 bits (300), Expect = 5e-25 Identities = 58/64 (90%), Positives = 61/64 (95%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENST EAKIVKDFDK EMILQA+EYENEQGKDLEEFFQSTAGKFQTELGKAWA+EI S Sbjct: 193 YEENSTAEAKIVKDFDKAEMILQAVEYENEQGKDLEEFFQSTAGKFQTELGKAWAAEIVS 252 Query: 114 RRRK 103 RR+K Sbjct: 253 RRKK 256 >ref|XP_002878700.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324539|gb|EFH54959.1| metal-dependent phosphohydrolase HD domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 257 Score = 119 bits (299), Expect = 6e-25 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVE+ILQALEYE QGKDLEEFFQSTAGKFQT++GKAWASEI S Sbjct: 192 YEENSSPEAKVVKDFDKVELILQALEYEQGQGKDLEEFFQSTAGKFQTDIGKAWASEIVS 251 Query: 114 RRRK*H 97 RRRK H Sbjct: 252 RRRKQH 257 >ref|XP_004309776.2| PREDICTED: HD domain-containing protein 2 [Fragaria vesca subsp. vesca] Length = 245 Score = 119 bits (297), Expect = 1e-24 Identities = 57/64 (89%), Positives = 62/64 (96%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YE NS+PEAKIVKDFDKVEMILQALEYEN+QGKDLEEFFQSTAGKFQT+ GKAWA+EIAS Sbjct: 180 YEGNSSPEAKIVKDFDKVEMILQALEYENDQGKDLEEFFQSTAGKFQTDAGKAWAAEIAS 239 Query: 114 RRRK 103 RR+K Sbjct: 240 RRKK 243 >ref|XP_010904602.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Elaeis guineensis] gi|743864516|ref|XP_010904603.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Elaeis guineensis] gi|743864520|ref|XP_010904604.1| PREDICTED: HD domain-containing protein 2 isoform X2 [Elaeis guineensis] Length = 258 Score = 119 bits (297), Expect = 1e-24 Identities = 57/64 (89%), Positives = 62/64 (96%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVEMILQALEYE EQG DL+EFFQSTAGKFQT++GKAWASEIAS Sbjct: 193 YEENSSPEAKVVKDFDKVEMILQALEYEKEQGIDLDEFFQSTAGKFQTDVGKAWASEIAS 252 Query: 114 RRRK 103 RRRK Sbjct: 253 RRRK 256 >ref|XP_009772323.1| PREDICTED: HD domain-containing protein 2 homolog [Nicotiana sylvestris] gi|698562134|ref|XP_009772324.1| PREDICTED: HD domain-containing protein 2 homolog [Nicotiana sylvestris] Length = 252 Score = 119 bits (297), Expect = 1e-24 Identities = 56/64 (87%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+ EAK+VKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQT++GKAWA+E+AS Sbjct: 187 YEENSSLEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTDVGKAWAAEVAS 246 Query: 114 RRRK 103 RR+K Sbjct: 247 RRKK 250 >ref|XP_009626145.1| PREDICTED: HD domain-containing protein 2 homolog [Nicotiana tomentosiformis] gi|697098324|ref|XP_009626150.1| PREDICTED: HD domain-containing protein 2 homolog [Nicotiana tomentosiformis] Length = 245 Score = 119 bits (297), Expect = 1e-24 Identities = 56/64 (87%), Positives = 63/64 (98%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+ EAK+VKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQT++GKAWA+E+AS Sbjct: 180 YEENSSLEAKVVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTDVGKAWAAEVAS 239 Query: 114 RRRK 103 RR+K Sbjct: 240 RRKK 243 >ref|XP_006294862.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] gi|482563570|gb|EOA27760.1| hypothetical protein CARUB_v10023915mg [Capsella rubella] Length = 250 Score = 119 bits (297), Expect = 1e-24 Identities = 56/66 (84%), Positives = 62/66 (93%) Frame = -1 Query: 294 YEENSTPEAKIVKDFDKVEMILQALEYENEQGKDLEEFFQSTAGKFQTELGKAWASEIAS 115 YEENS+PEAK+VKDFDKVE+ILQALEYE QGKDLEEFFQSTAGKFQT++GKAWA+EI S Sbjct: 185 YEENSSPEAKVVKDFDKVELILQALEYEQAQGKDLEEFFQSTAGKFQTDIGKAWAAEIVS 244 Query: 114 RRRK*H 97 RRRK H Sbjct: 245 RRRKQH 250